[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55811.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  49/915 : Eukaryota  9/199 : Viruses  0/175   --->[See Alignment]
d.269.1
:173 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->173 2pn7B PDBj 2e-10 27.0 %
:RPS:PDB   18->160 3cryB PDBj 3e-21 24.3 %
:RPS:SCOP  18->133 1xhsA  d.269.1.1 * 1e-16 19.2 %
:HMM:SCOP  15->144 1v30A_ d.269.1.1 * 1.5e-14 23.9 %
:RPS:PFM   51->119 PF07274 * DUF1440 2e-04 34.8 %
:HMM:PFM   20->125 PF06094 * AIG2 2.6e-06 20.2 99/104  
:BLT:SWISS 17->173 GGCT_HUMAN 5e-10 27.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55811.1 GT:GENE BAD55811.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1065441..1065962) GB:FROM 1065441 GB:TO 1065962 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55811.1 LENGTH 173 SQ:AASEQ MPGELCTEQANLCYVPIYAAYGSNMDSSQMLERCPHSPMSGTGWLEGWRLTFAGDDIGWEGPLATVVEDPGSRVFVVLYDVSPEDEQRLDRWEGSDFGIHKKIRLRVTPNPGSGTEPRLAWLYVLDAYEGGLPSARYLGVMADAAEKAGAPADYVHALRTRNSRNVGPGNFSG GT:EXON 1|1-173:0| BL:SWS:NREP 1 BL:SWS:REP 17->173|GGCT_HUMAN|5e-10|27.0|148/188| SEG 142->152|adaaekagapa| BL:PDB:NREP 1 BL:PDB:REP 17->173|2pn7B|2e-10|27.0|148/169| RP:PDB:NREP 1 RP:PDB:REP 18->160|3cryB|3e-21|24.3|140/169| RP:PFM:NREP 1 RP:PFM:REP 51->119|PF07274|2e-04|34.8|66/133|DUF1440| HM:PFM:NREP 1 HM:PFM:REP 20->125|PF06094|2.6e-06|20.2|99/104|AIG2| RP:SCP:NREP 1 RP:SCP:REP 18->133|1xhsA|1e-16|19.2|99/113|d.269.1.1| HM:SCP:REP 15->144|1v30A_|1.5e-14|23.9|113/0|d.269.1.1|1/1|BtrG-like| OP:NHOMO 64 OP:NHOMOORG 58 OP:PATTERN -------------------------------------------------------------------- --------------11111-31111111111111111111-1111---------------111-1111111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------21------2-----2-2-1-------1---------------------------------------------1--1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ---------------------------------------------------11----------------------------------------1----------------1-----------1----------------------------------1-----1-----1----1------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 152 STR:RPRED 87.9 SQ:SECSTR ################EEEEccGGGcHHHHHHHcTTcEEEEEEEEEEEEEEEEEETTcTcccEEEEEEEEEEEEEEEEEEEEGGGHHHHHHHTTTTTTccEEEEEEEEETTccEEcEEEEEEEEcccEEEccccHHHHHHHHHHHHHTTccHHHHHHHHT#####cccccccc DISOP:02AL 1-3, 163-173| PSIPRED ccccccccHHcccccEEEEEEcccccHHHHHHHcccccEEEEEEEccEEEEEccccccccccccEEEEccccEEEEEEEEEcHHHHHHHHHHccccccccEEEEEEEEEcccccEEEEEEEEEEEcccccccccHHHHHHHHHHHHHHcccHHHHHHHHcccccccccccccc //