[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55813.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:340 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 8->171 PLS_STAES 2e-07 29.0 %
:REPEAT 3|62->77|85->103|158->168
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55813.1 GT:GENE BAD55813.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1067871..1068893 GB:FROM 1067871 GB:TO 1068893 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55813.1 LENGTH 340 SQ:AASEQ MATLFAAPAGAVPNEPSTPATPAPVQPGTNDAPQGTDTPGTAQPGQGSPEQGSPGQGDEKKKPENKPTPSQPGVTTPEPEQVMPEPEKDPKLATPTQPGVTTPRVAPLPVPGQSDQPQPAVAPENGAQTPESVAPGAGEQGAQQDTPAADDGQARPAQPERRVTPSQPESQTETLVQEPRWEAPRLEAAPAAPVVEMTGPHQEFGANVDGGAVLPGYVANTHHFSNEAGYVGTIGYRTPTGAGEAGASVEFLDVNTVKVTTYTGGEGLADNKNAFVLDTTQVNAAKAAVEQWIAAQPGGAAALEAAAQVKLPPLVPAGDLAPQTVNVAGVTTQWGGSFQY GT:EXON 1|1-340:0| BL:SWS:NREP 1 BL:SWS:REP 8->171|PLS_STAES|2e-07|29.0|138/1469| NREPEAT 1 REPEAT 3|62->77|85->103|158->168| SEG 43->57|qpgqgspeqgspgqg| SEG 178->196|eprweaprleaapaapvve| SEG 294->308|aaqpggaaaleaaaq| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 8-216| PSIPRED cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccEEcccccccccccEEEEEccEEEEEEEEcccccccccccEEEcHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHccccccccccccccEEEEEEEEEcccccccc //