Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55819.1
DDBJ      :             hypothetical protein

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:58 amino acids

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55819.1 GT:GENE BAD55819.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1075985..1076161) GB:FROM 1075985 GB:TO 1076161 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55819.1 LENGTH 58 SQ:AASEQ MPRRPRTAGPPILAVATRLLVAVLCCAATALFSYALLQLPTPAGTAETPRPAIVAPHP GT:EXON 1|1-58:0| TM:NTM 1 TM:REGION 12->34| SEG 13->31|lavatrllvavlccaatal| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8, 57-58| PSIPRED cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEcccc //