[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55820.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  55/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.60.1
:204 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   31->166 1h2eA PDBj 2e-07 33.6 %
:RPS:PDB   31->202 1c7zA PDBj 1e-17 21.6 %
:RPS:SCOP  31->202 1bifA2  c.60.1.4 * 2e-16 21.2 %
:HMM:SCOP  30->197 1k6mA2 c.60.1.4 * 4.8e-31 37.1 %
:RPS:PFM   31->166 PF00300 * PGAM 1e-11 41.2 %
:HMM:PFM   33->167 PF00300 * PGAM 1.5e-16 36.3 135/158  
:BLT:SWISS 72->166 F262_BOVIN 5e-06 33.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55820.1 GT:GENE BAD55820.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1076267..1076881) GB:FROM 1076267 GB:TO 1076881 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55820.1 LENGTH 204 SQ:AASEQ MHPRTDRPAAADPRRRAGARTLRCVRTVLGLDLVGHGMTEAMRAARFPADEPLTEGGRNALAGRRPSRAATVLTAPERRAVETAELLGLTATVDERLRDLDAGAWRGADLAAIPEEHLRDWLSDPEFRGHGGESVLDVLARTGRWLADVADSGRSTVAVTHPAVIRAALVVALDAPPAAFWRLDVGPGAVVRLRHRGRWSLRLP GT:EXON 1|1-204:0| BL:SWS:NREP 1 BL:SWS:REP 72->166|F262_BOVIN|5e-06|33.0|94/531| SEG 3->21|prtdrpaaadprrragart| SEG 167->179|aalvvaldappaa| BL:PDB:NREP 1 BL:PDB:REP 31->166|1h2eA|2e-07|33.6|134/207| RP:PDB:NREP 1 RP:PDB:REP 31->202|1c7zA|1e-17|21.6|171/191| RP:PFM:NREP 1 RP:PFM:REP 31->166|PF00300|1e-11|41.2|136/158|PGAM| HM:PFM:NREP 1 HM:PFM:REP 33->167|PF00300|1.5e-16|36.3|135/158|PGAM| RP:SCP:NREP 1 RP:SCP:REP 31->202|1bifA2|2e-16|21.2|170/219|c.60.1.4| HM:SCP:REP 30->197|1k6mA2|4.8e-31|37.1|167/219|c.60.1.4|1/1|Phosphoglycerate mutase-like| OP:NHOMO 59 OP:NHOMOORG 55 OP:PATTERN -------------------------------------------------------------------- ---------------11----1--11-----111111----211--------1--------------312------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------1--1---11-111--1--1--------1-1---------1--1-------------------------------------------1111111------11------1-1---1-----------------------------------------------------------------------------------------------11---------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------1111-1111----------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 178 STR:RPRED 87.3 SQ:SECSTR #########################ccccTEEEEEccccHHHHTTcccccccccHHHHHHHHHHTTccccEEEEEccHHHHHHHHTTccccEEEGGGcccccGGGTTccHHHHHHHHHHHHHcTTTcccTTcccHHHHHHHHHHHHHHHHTTcccEEEEEcHHHHHHHHHHHTTccTTTGGGccccccEEEEEEETTEEEEEE# DISOP:02AL 1-18| PSIPRED ccccccccccccccccccccccccccEEEEEEEEEcccccccHHccccccccccHHHHHHHHHHcccccEEEEEccHHHHHHHHHHHcccEEEHHHHHHccccccccccHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHHHcccHHHHHccccccEEEEEEEEcccEEEEcc //