[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55822.1
DDBJ      :             putative endonuclease VIII
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  139/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.156.1b.113.1g.39.1
:259 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->255 1k3wA PDBj 2e-19 38.2 %
:RPS:PDB   2->258 1ee8A PDBj 5e-33 31.8 %
:RPS:SCOP  2->122 1k82A2  b.113.1.1 * 9e-13 22.0 %
:RPS:SCOP  122->176 1k3wA1  a.156.1.2 * 3e-15 40.0 %
:RPS:SCOP  210->258 1ee8A3  g.39.1.8 * 7e-11 54.1 %
:HMM:SCOP  2->123 1k3xA2 b.113.1.1 * 2.1e-28 28.1 %
:HMM:SCOP  121->204 1tdhA1 a.156.1.2 * 5.4e-20 35.7 %
:HMM:SCOP  192->259 1ee8A3 g.39.1.8 * 3.4e-08 37.5 %
:RPS:PFM   122->176 PF06831 * H2TH 2e-08 50.0 %
:HMM:PFM   122->200 PF06831 * H2TH 1.8e-18 38.7 75/93  
:HMM:PFM   2->100 PF01149 * Fapy_DNA_glyco 8e-14 32.6 95/116  
:HMM:PFM   216->227 PF06827 * zf-FPG_IleRS 0.00067 41.7 12/30  
:HMM:PFM   239->256 PF06827 * zf-FPG_IleRS 2.9e-05 50.0 18/30  
:BLT:SWISS 1->255 Y5760_STRCO 8e-56 47.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55822.1 GT:GENE BAD55822.1 GT:PRODUCT putative endonuclease VIII GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1081632..1082411 GB:FROM 1081632 GB:TO 1082411 GB:DIRECTION + GB:PRODUCT putative endonuclease VIII GB:PROTEIN_ID BAD55822.1 LENGTH 259 SQ:AASEQ MPEGDTVFRAAHRLHLALAGKTLVRSDFRVPRYATVDLVGERVEEVTSYGKHLFIRTADASIHTHLKMEGVWRTYCVGERWTRPRVQARVVLTTDDTEAVGFALGKVEVLRRADEHTVIDHLGPDLLGPDWDPAEAERRLASVPERPIGLALLDQRNLAGIGNIYRSEICFLRRVHPATPVAAVPDLPAVVSEAHRVLGAAAHQPPWRPMVYGRTGLPCRRCGTRIQARPLGEPTPVSDRIVQRERGIFFCPRCQPTGE GT:EXON 1|1-259:0| BL:SWS:NREP 1 BL:SWS:REP 1->255|Y5760_STRCO|8e-56|47.4|247/276| SEG 9->19|raahrlhlala| SEG 177->191|patpvaavpdlpavv| BL:PDB:NREP 1 BL:PDB:REP 2->255|1k3wA|2e-19|38.2|241/254| RP:PDB:NREP 1 RP:PDB:REP 2->258|1ee8A|5e-33|31.8|236/266| RP:PFM:NREP 1 RP:PFM:REP 122->176|PF06831|2e-08|50.0|54/92|H2TH| HM:PFM:NREP 4 HM:PFM:REP 122->200|PF06831|1.8e-18|38.7|75/93|H2TH| HM:PFM:REP 2->100|PF01149|8e-14|32.6|95/116|Fapy_DNA_glyco| HM:PFM:REP 216->227|PF06827|0.00067|41.7|12/30|zf-FPG_IleRS| HM:PFM:REP 239->256|PF06827|2.9e-05|50.0|18/30|zf-FPG_IleRS| GO:PFM:NREP 5 GO:PFM GO:0003684|"GO:damaged DNA binding"|PF06831|IPR015886| GO:PFM GO:0003906|"GO:DNA-(apurinic or apyrimidinic site) lyase activity"|PF06831|IPR015886| GO:PFM GO:0006289|"GO:nucleotide-excision repair"|PF06831|IPR015886| GO:PFM GO:0008270|"GO:zinc ion binding"|PF06831|IPR015886| GO:PFM GO:0016799|"GO:hydrolase activity, hydrolyzing N-glycosyl compounds"|PF06831|IPR015886| RP:SCP:NREP 3 RP:SCP:REP 2->122|1k82A2|9e-13|22.0|118/128|b.113.1.1| RP:SCP:REP 122->176|1k3wA1|3e-15|40.0|55/90|a.156.1.2| RP:SCP:REP 210->258|1ee8A3|7e-11|54.1|37/56|g.39.1.8| HM:SCP:REP 2->123|1k3xA2|2.1e-28|28.1|121/124|b.113.1.1|1/1|N-terminal domain of MutM-like DNA repair proteins| HM:SCP:REP 121->204|1tdhA1|5.4e-20|35.7|84/115|a.156.1.2|1/1|S13-like H2TH domain| HM:SCP:REP 192->259|1ee8A3|3.4e-08|37.5|56/56|g.39.1.8|1/1|Glucocorticoid receptor-like (DNA-binding domain)| OP:NHOMO 157 OP:NHOMOORG 139 OP:PATTERN -------------------------------------------------------------------- 2111111111111121212-12--2211111221111122-2-132111211111111--1-2-211111-----------------------------------1--------------------------------------------------------------------1-----1---------------------------------------1----1---1---------------------------11---------111----1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------1111-------------------------------------------------------------------1------11--11-1111111111--11111111111111111--1111---111111111111111111111111----------------------------------------------------------------------------------------------------1------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 258 STR:RPRED 99.6 SQ:SECSTR EccHHHHHHHHHHHHHHHTTcEEEEEEcccTTTEEcGGTTEEEEEEEEETTEEEEETTTEEEEEEcTTTcEEEccEEEcTTccccTTEEEEEEEcccEEEEEcccEEEEEETTcccTHHHHccccTTcTTccHHHHHHHHHTTccccHHHHHHHccccTTccHHHHHHHHHHTTccHHHHHHHHHHHHHHHHHHHHTTccccccTTcccccTTcTTcccTTTccccETTccccTTccccEEEccccEEEEcTTTTTcc# DISOP:02AL 257-259| PSIPRED cccHHHHHHHHHHHHHHHcccEEEEEEEccccHHHHHHcccEEEEEEEcccEEEEEEcccEEEEEEEEEEEEEEEEcccccccccccEEEEEEEccccEEEEEEEEEEEEcccccHHHHHHHccccccccccHHHHHHHHHHcccccHHHHHHcccEEEcccHHHHHHHHHHHcccHHHHHccHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccccEEEEEEEccccccEEEEEEcccEEEEccccccccc //