[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55824.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  11/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:123 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   11->123 PF05331 * DUF742 1e-08 40.5 %
:HMM:PFM   12->123 PF05331 * DUF742 4.6e-31 45.5 112/114  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55824.1 GT:GENE BAD55824.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1084575..1084946) GB:FROM 1084575 GB:TO 1084946 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55824.1 LENGTH 123 SQ:AASEQ MNDRRESWFDDEAGPLVRLYAVTRGRSDARPDLNMLTLVVYSGSGTLRRTEPEYAEILRLSRTVQSIAELAAQLHLPLTTTKVLVGDLIDDGLLDFRAPEPTPDAGPRDLGTLRAVLRGIQAL GT:EXON 1|1-123:0| SEG 83->95|vlvgdliddglld| RP:PFM:NREP 1 RP:PFM:REP 11->123|PF05331|1e-08|40.5|111/112|DUF742| HM:PFM:NREP 1 HM:PFM:REP 12->123|PF05331|4.6e-31|45.5|112/114|DUF742| OP:NHOMO 14 OP:NHOMOORG 11 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2----112----------------1---11112-1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2, 103-104| PSIPRED cccccccccccccccccccEEEEccccccccccEEEEEEEEccccccccccHHHHHHHHHHcccccHHHHHHHccccHHHHHHHHHHHHHccEEEEEccccccccccccHHHHHHHHHHHHcc //