[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55825.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.110.7
:130 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   2->113 1a0kA PDBj 7e-18 17.9 %
:RPS:SCOP  2->113 1skoB  d.110.7.1 * 1e-20 20.0 %
:HMM:SCOP  2->119 1j3wA_ d.110.7.1 * 6.7e-31 39.3 %
:RPS:PFM   4->88 PF03259 * Robl_LC7 5e-12 41.7 %
:HMM:PFM   1->89 PF03259 * Robl_LC7 6.8e-25 36.4 88/91  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55825.1 GT:GENE BAD55825.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1084943..1085335) GB:FROM 1084943 GB:TO 1085335 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55825.1 LENGTH 130 SQ:AASEQ MLDDLIERLPDVRYAVVLSTDGLLLGHSTKIDRSDAERFCAMASTLHGVARSAGVHFEAGGVCQTVVELDRAVLFITAAGDNACLAVLTSESANMGMVAYEMNQTVQRVGAHLSVDPRPHPFDEVGMRQP GT:EXON 1|1-130:0| RP:PDB:NREP 1 RP:PDB:REP 2->113|1a0kA|7e-18|17.9|112/130| RP:PFM:NREP 1 RP:PFM:REP 4->88|PF03259|5e-12|41.7|84/90|Robl_LC7| HM:PFM:NREP 1 HM:PFM:REP 1->89|PF03259|6.8e-25|36.4|88/91|Robl_LC7| RP:SCP:NREP 1 RP:SCP:REP 2->113|1skoB|1e-20|20.0|110/116|d.110.7.1| HM:SCP:REP 2->119|1j3wA_|6.7e-31|39.3|117/0|d.110.7.1|1/1|Roadblock/LC7 domain| OP:NHOMO 98 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- ----4----------11----1---1------1---6112-4352---1-----------64--565CA96---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 112 STR:RPRED 86.2 SQ:SECSTR #HHHHTccccTccEEEEEETTccEEEEcTTcccccHHHHHHHHHHHHcTTccTTTcEEETTEEEEEEEEETTTEEEEEETTEEEEEEEcccEEETTccHHHHHHHHHHHHHHH################# DISOP:02AL 122-130| PSIPRED cHHHHHHcccccEEEEEEcccccEEEcccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEcccEEEEEEcccccEEEEEccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccc //