[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55828.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  18/68 : Bacteria  415/915 : Eukaryota  2/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.58.4
:129 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->127 2vbwA PDBj 2e-52 78.6 %
:RPS:PDB   3->129 2cyyA PDBj 6e-16 26.6 %
:RPS:SCOP  1->48 1i1gA1  a.4.5.32 * 1e-12 41.7 %
:RPS:SCOP  51->129 1ri7A2  d.58.4.2 * 2e-11 21.8 %
:HMM:SCOP  1->49 2cg4A1 a.4.5.32 * 6e-11 53.1 %
:HMM:SCOP  50->129 2cfxA2 d.58.4.2 * 1.6e-12 28.6 %
:HMM:PFM   61->125 PF01037 * AsnC_trans_reg 2.5e-15 32.3 65/74  
:HMM:PFM   4->36 PF01047 * MarR 8e-06 39.4 33/59  
:BLT:SWISS 3->126 REG1_PYRHO 9e-14 35.8 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55828.1 GT:GENE BAD55828.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1089875..1090264 GB:FROM 1089875 GB:TO 1090264 GB:DIRECTION + GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD55828.1 LENGTH 129 SQ:AASEQ MADGRATLSNLAEKASLSVSAVQSRVRRLEARGVIRGYTAKVDPEALGQLLSAFVAITPLDPSQPDDAPAVLQHIPGIEACHSVAGDESYVLLVRVASPRHLEQLLQEIRATANVRTRSTIILQTFYDR GT:EXON 1|1-129:0| BL:SWS:NREP 1 BL:SWS:REP 3->126|REG1_PYRHO|9e-14|35.8|123/155| BL:PDB:NREP 1 BL:PDB:REP 2->127|2vbwA|2e-52|78.6|126/147| RP:PDB:NREP 1 RP:PDB:REP 3->129|2cyyA|6e-16|26.6|124/147| HM:PFM:NREP 2 HM:PFM:REP 61->125|PF01037|2.5e-15|32.3|65/74|AsnC_trans_reg| HM:PFM:REP 4->36|PF01047|8e-06|39.4|33/59|MarR| RP:SCP:NREP 2 RP:SCP:REP 1->48|1i1gA1|1e-12|41.7|48/60|a.4.5.32| RP:SCP:REP 51->129|1ri7A2|2e-11|21.8|78/86|d.58.4.2| HM:SCP:REP 1->49|2cg4A1|6e-11|53.1|49/0|a.4.5.32|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 50->129|2cfxA2|1.6e-12|28.6|77/0|d.58.4.2|1/1|Dimeric alpha+beta barrel| OP:NHOMO 958 OP:NHOMOORG 435 OP:PATTERN --------111111-12--------111--1-----------------------212-11----2--- -1--6------1--22223-23--2222222322221133111121-2-11-221-1---661142566411111-11---------------1-------11--1-11----------------11111111111-------------1---------------------------------211-------1111111212211111-11111121---111-------1------------------------1--11---1111----------------------------------------------------------11---1-11-1--2-------------11---------------------2333-------325---1-12-44544453555---1--2-12A--244433C3364332-112443333136--------22211113-------------------------------3232444569897964433355646666487744555--556244333-2-8--11----3---111-1---12---1-111--11----1-1----------11-----------------------------11211-213213222211111122112211--1----------11131111111111111-1111111111111111111222131211111111111111111311111111-111111111111---2-----------313---------------34332321-12155653837247421234----------112122222345332222222111--------------------------------------------------------------- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1--------------1---------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 129 STR:RPRED 100.0 SQ:SECSTR HHcTTccHHHHHHHHcccHHHHHHHHHHHHHHTccccccccccGGGGTccEEEEEEEEEEcTTcHHHHHHHHHTcTTEEEEEEcccccccEEEEEEccHHHHHHHHHHHHTcTTEEEEEEccccccccc DISOP:02AL 129-130| PSIPRED cccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEccEEEEcHHHccccEEEEEEEEEccccHHHHHHHHHHccccEEEEEEEEccccEEEEEEEccHHHHHHHHHHHHcccccEEEEEEEEEEEEcc //