[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55830.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  17/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:113 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   11->68 PF02979 * NHase_alpha 0.00074 32.8 58/189  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55830.1 GT:GENE BAD55830.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1091682..1092023) GB:FROM 1091682 GB:TO 1092023 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55830.1 LENGTH 113 SQ:AASEQ MMEPIEINAGTWYLRALRADERIDDRPALAEGGITDPEHVARRAADWAEETRYSWAVCEPTTAELMAEIVLTPGADGTAEITGWARVGQEPALAAARTAVARFAEGALGLRTA GT:EXON 1|1-113:0| SEG 92->107|alaaartavarfaega| HM:PFM:NREP 1 HM:PFM:REP 11->68|PF02979|0.00074|32.8|58/189|NHase_alpha| OP:NHOMO 17 OP:NHOMOORG 17 OP:PATTERN -------------------------------------------------------------------- ------1-111-1-1------1---1------11111111-------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-2| PSIPRED ccccEEccccEEEEEcccccccccccHHHHHHHcccHHHHHHHHHHHHHccEEEEEEcccccHHHHHHHHcccccccEEEEcccccccccccHHHHHHHHHHHHHcccccccc //