[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55832.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  7/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:355 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   235->342 3cfuB PDBj 2e-18 14.0 %
:RPS:PFM   247->340 PF11611 * TRF2 5e-05 34.1 %
:HMM:PFM   231->347 PF11611 * TRF2 3e-18 29.2 113/123  
:HMM:PFM   130->193 PF03631 * Ribonuclease_BN 0.00063 23.8 42/258  
:BLT:SWISS 1->77 SELPL_MOUSE 8e-04 34.8 %
:PROS 284->292|PS00995|TCP1_3
:TM
:REPEAT 3|25->34|35->54|55->74
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55832.1 GT:GENE BAD55832.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1093324..1094391 GB:FROM 1093324 GB:TO 1094391 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55832.1 LENGTH 355 SQ:AASEQ MTGTTGTPAPVHREPVRARWVPPSAPAPDPLRHDPPAPEPLRHNPPAADPARGTPPAPDRARGIPPAADRVRGTPPASIPARRNPLVPAPARRNPPAPAPSRGTAPASIVRPVLPAPGARQWYLRRKASTQKAVRRTWGPAWPARRPGPVAPPPPRRRRRGGLVRKLLWATLLVVLAPFVLAVGCLAALAANSGDGGEPATGAPPPAAVVEEPPPGEPDPAGPVAGPAPAGTPVRDGKFEFRVAAMESGVPRVGLQTARGAFAIVTLAVRNISDQPKWFLPFGQKLVTGDGTVVEHDTTATAWQAVQHRLGHSFEVAPGASGTAVLVFDVPAHTAPAHLELHDFVLSGGVTVAVS GT:EXON 1|1-355:0| BL:SWS:NREP 1 BL:SWS:REP 1->77|SELPL_MOUSE|8e-04|34.8|69/100| PROS 284->292|PS00995|TCP1_3|PDOC00610| TM:NTM 1 TM:REGION 167->189| NREPEAT 1 REPEAT 3|25->34|35->54|55->74| SEG 80->102|parrnplvpaparrnppapapsr| SEG 138->165|wgpawparrpgpvapppprrrrrgglvr| SEG 170->191|atllvvlapfvlavgclaalaa| SEG 194->234|gdggepatgapppaavveepppgepdpagpvagpapagtpv| RP:PDB:NREP 1 RP:PDB:REP 235->342|3cfuB|2e-18|14.0|100/131| RP:PFM:NREP 1 RP:PFM:REP 247->340|PF11611|5e-05|34.1|85/120|TRF2| HM:PFM:NREP 2 HM:PFM:REP 231->347|PF11611|3e-18|29.2|113/123|TRF2| HM:PFM:REP 130->193|PF03631|0.00063|23.8|42/258|Ribonuclease_BN| OP:NHOMO 7 OP:NHOMOORG 7 OP:PATTERN -------------------------------------------------------------------- ----------------1--------1------11-11---------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 100 STR:RPRED 28.2 SQ:SECSTR ##########################################################################################################################################################################################################################################EETTEEEEEEEEE##ccccEccccccccEEEEE#EEEcccccEEEEGGGEEEEcTTcccccEEEcGGGTTcc#####cEEEEcTTcEEEEEEEEcccccccEEEEcHH############# DISOP:02AL 8-183, 190-227| PSIPRED cccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEccccccHHccccccccEEEEEEEEEEccccccEEcccccEEEEccccEEccccccEEHHHHHcccHHHEEccccccEEEEEEEEcccccccEEEEEEcccccccEEEEEc //