[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55836.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:254 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   7->50 1bibA PDBj 1e-05 18.6 %
:RPS:SCOP  7->50 1oyiA  a.4.5.19 * 3e-04 18.2 %
:HMM:SCOP  7->182 2p4wA1 a.4.5.64 * 4.7e-18 31.4 %
:HMM:PFM   9->52 PF09339 * HTH_IclR 6.5e-07 36.4 44/52  
:HMM:PFM   52->74 PF09998 * DUF2239 0.0009 47.8 23/187  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55836.1 GT:GENE BAD55836.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1098594..1099358 GB:FROM 1098594 GB:TO 1099358 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55836.1 LENGTH 254 SQ:AASEQ MSDSWPRRRLLAILRGASEPLDAQELARITGQHVTTVRFHLDVLTKESLVRQFQQPPRGRGRPRIGYRAVQRTLGYQELAQVLAEQLGPDSRSRSEAAVAAGRAWGAKLDAEERRIETLADVREVTVGLLSELGFAPERDPSGEESDQVVIRMTGCPLRDLARTHTDVVCGVHLGLIEEVLDRSGERGAVNVRLHPFVEPELCVARLELARRAAVPIGAENEAEPALTPPSAGRVAPQLRNADPNVAKQSAQQW GT:EXON 1|1-254:0| SEG 51->68|rqfqqpprgrgrprigyr| SEG 91->107|srsrseaavaagrawga| SEG 201->215|elcvarlelarraav| RP:PDB:NREP 1 RP:PDB:REP 7->50|1bibA|1e-05|18.6|43/294| HM:PFM:NREP 2 HM:PFM:REP 9->52|PF09339|6.5e-07|36.4|44/52|HTH_IclR| HM:PFM:REP 52->74|PF09998|0.0009|47.8|23/187|DUF2239| RP:SCP:NREP 1 RP:SCP:REP 7->50|1oyiA|3e-04|18.2|44/62|a.4.5.19| HM:SCP:REP 7->182|2p4wA1|4.7e-18|31.4|169/0|a.4.5.64|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 30 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- --------------11111-11--1111111121211-12----------------------3--1----1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 50 STR:RPRED 19.7 SQ:SECSTR ccccHHHHHHHHHHTTTcccccHHHHHHHHTccHHHHHHHHHHHHHTTcc############################################################################################################################################################################################################ DISOP:02AL 1-4, 54-60, 106-118, 244-246, 248-254| PSIPRED ccccHHHHHHHHHHHHccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEccccccccccEEEEEccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccEEEEEcccccccEEEEEccccHHHHHHcccHHHHHHHHHHHHHHHHHccccccEEEEEEccccccEEEEEEEHHHHccccccccccccccccccccccccHHHcccccHHHHHHHccc //