[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55837.1
DDBJ      :             putative septum formation protein
Swiss-Prot:Y992_NOCFA   RecName: Full=Maf-like protein NFA_9920;

Homologs  Archaea  8/68 : Bacteria  331/915 : Eukaryota  12/199 : Viruses  0/175   --->[See Alignment]
c.51.4
:212 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   74->180 1ex2A PDBj 5e-13 36.3 %
:RPS:PDB   4->183 2amhA PDBj 2e-25 16.1 %
:RPS:SCOP  3->183 2amhA1  c.51.4.2 * 2e-32 16.0 %
:HMM:SCOP  1->199 1ex2A_ c.51.4.2 * 5e-47 42.7 %
:RPS:PFM   5->183 PF02545 * Maf 5e-19 36.5 %
:HMM:PFM   4->203 PF02545 * Maf 7e-56 36.8 190/195  
:BLT:SWISS 1->212 Y992_NOCFA 2e-80 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55837.1 GT:GENE BAD55837.1 GT:PRODUCT putative septum formation protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1099284..1099922) GB:FROM 1099284 GB:TO 1099922 GB:DIRECTION - GB:PRODUCT putative septum formation protein GB:PROTEIN_ID BAD55837.1 LENGTH 212 SQ:AASEQ MTSTLVLASASPARRQVLRAAGIDPVVRVSDVDEDAVAAALPPDTAPATVVVELARAKAAAVAADIPEYAADCVVVGCDSMLLLDGELQGKPHTPEVARARWAQMAGRSAELVTGHCVLRLRGGAVVAEATDCSATTVHFAKPEPEELDAYLASGEPLQVAGAFTLDGLGGWFVDRIEGDPSSVIGIGLPLLRRLLGDVGVGVAQLWRHPAR GT:EXON 1|1-212:0| SW:ID Y992_NOCFA SW:DE RecName: Full=Maf-like protein NFA_9920; SW:GN OrderedLocusNames=NFA_9920; SW:KW Complete proteome; Cytoplasm. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->212|Y992_NOCFA|2e-80|100.0|212/212| GO:SWS:NREP 1 GO:SWS GO:0005737|"GO:cytoplasm"|Cytoplasm| SEG 26->64|vvrvsdvdedavaaalppdtapatvvvelarakaaavaa| SEG 184->203|vigiglpllrrllgdvgvgv| BL:PDB:NREP 1 BL:PDB:REP 74->180|1ex2A|5e-13|36.3|102/185| RP:PDB:NREP 1 RP:PDB:REP 4->183|2amhA|2e-25|16.1|174/195| RP:PFM:NREP 1 RP:PFM:REP 5->183|PF02545|5e-19|36.5|170/193|Maf| HM:PFM:NREP 1 HM:PFM:REP 4->203|PF02545|7e-56|36.8|190/195|Maf| GO:PFM:NREP 1 GO:PFM GO:0005737|"GO:cytoplasm"|PF02545|IPR003697| RP:SCP:NREP 1 RP:SCP:REP 3->183|2amhA1|2e-32|16.0|175/195|c.51.4.2| HM:SCP:REP 1->199|1ex2A_|5e-47|42.7|185/0|c.51.4.2|1/1|ITPase-like| OP:NHOMO 411 OP:NHOMOORG 351 OP:PATTERN -------------------------------------------------1111----1111------- --1-111111111111111-11111111111111111111----11111111111111--1111111111-1-111111--1-------------------------------------------1----------1--11-----11111111111111111111-11111111---1111------11--11111111111111111-11111111111---1-------1---------------------------------------------------------------------------------------------1-111-111-1-11--11-1-1---1--1111---1111111-1---------------------------------------------------------------------------------------------------------------------------------------------1111122--11111--1--11-1-------------------1--1------1-----2--1-11111-------111-1--1-11111-11---------------------------11-12--1---1211211--112211-1----11212------22212222222222222-2222222222222222222222--11-111111111111111112212222---------------------------2-111111---1-------1111111----2-12111--121111112--------------1-----11-11-1-1-11---------1--------------------------------------------1----------- ------------------------------------------------------------------------------------------------------------2--------------------------------------------------111----1111-----1------------------11-1- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 182 STR:RPRED 85.8 SQ:SECSTR TTcEEEEccccHHHHHHHHHHHTTTccEEEEccccccGGGcccccHHHHHHHHHHHHHHHHHH#ccHHHTccEEEEEEEEEEEETTEEEcccccHHHHHHHHHHHTTcEEEEEEEEEEEETTcccEEETTEEEEEEEEEEccccHHHHHHHHHHcGGGGcGGGccTTcHHHTTEEEEEccHHH############################# DISOP:02AL 211-212| PSIPRED ccccEEEccccHHHHHHHHHccccEEEEEccccccHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcEEEEEccEEccccccHHHHHHHHHHHcccEEEEEEEEEEEEccccEEEEEEEEEEEEEEEEccccHHHHHHHHHccccccccEEEEEcHHHHHHHHHHccccccEEcccHHHHHHHHHHccccHHHHcccccc //