[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55838.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:126 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55838.1 GT:GENE BAD55838.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1099932..1100312) GB:FROM 1099932 GB:TO 1100312 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55838.1 LENGTH 126 SQ:AASEQ MSRSEGTRLIEIERGSGTVTTVAEEEVLTAAELDLAVEPVTDAAESEASTDAPTAEAGAAPFLRILKGSPTDEEIAALVCVFAAAGNGGQDSGPARPLDMWGRPTLMHRGTSPFSPYAFPQLSQLR GT:EXON 1|1-126:0| SEG 18->38|tvttvaeeevltaaeldlave| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1--1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 8-9, 43-59, 86-99| PSIPRED cccccccEEEEEEcccccEEEEcHHHHHHHHHccEEEccccccccccccccccccccccccEEEEEEccccHHHHHHHHHHHHHcccccccccccccHHHcccHHHHHccccccccccccHHHccc //