[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55839.1
DDBJ      :             putative acyl-CoA carboxylase beta subunit
Swiss-Prot:             

Homologs  Archaea  31/68 : Bacteria  688/915 : Eukaryota  162/199 : Viruses  0/175   --->[See Alignment]
c.14.1
:546 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->546 2a7sA PDBj 0.0 83.5 %
:RPS:PDB   17->546 2a7sA PDBj 3e-90 80.5 %
:RPS:SCOP  20->269 1on3A1  c.14.1.4 * 1e-88 50.2 %
:RPS:SCOP  272->545 1on3A2  c.14.1.4 * 3e-80 51.3 %
:HMM:SCOP  17->276 2a7sA1 c.14.1.4 * 1.7e-81 42.0 %
:HMM:SCOP  283->546 1od2A2 c.14.1.4 * 4e-97 43.9 %
:RPS:PFM   52->528 PF01039 * Carboxyl_trans e-119 53.5 %
:HMM:PFM   46->544 PF01039 * Carboxyl_trans 4.1e-202 53.5 488/493  
:BLT:SWISS 17->546 PCC5_MYCTU 0.0 83.5 %
:REPEAT 2|57->190|313->432
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55839.1 GT:GENE BAD55839.1 GT:PRODUCT putative acyl-CoA carboxylase beta subunit GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1100359..1101999) GB:FROM 1100359 GB:TO 1101999 GB:DIRECTION - GB:PRODUCT putative acyl-CoA carboxylase beta subunit GB:PROTEIN_ID BAD55839.1 LENGTH 546 SQ:AASEQ MTSVQQQSASGSAGSPDIHTTAGKLADLRNRLEEAKHPMGEAVVDKVHAKGKMTARERILALLDEGSFVELDALARHRSVNFGLENNRPLGDGVVTGYGTIDGRDVCIFSQDVTVFGGSLGEVYGEKIVKVMDLALKTGRPLIGINEGAGARIQEGVVSLGLYGEIFHRNIQASGVIPQISLIMGPAAGGHVYSPALTDFVVMVDQTSQMFVTGPDVIKTVTGEEVTMEELGGAHTHMVKSGVAHYVASGEQDALDYVKDLLSYLPSNNRAEPPRFPATDPIEGAIEDSLTDEDLELDTIIPDSPNQPYDMHEVIRRLLDDDEFLEVQAERAMNIIVGFGRIDGRSVGIVANQPTQFAGCLDIDASEKAARFVRTCDAFNVPIITLVDVPGFLPGTGQEYNGIIRRGAKLLYAYGEATVGKITIITRKAYGGAYDVMGSKHMGADVNLAWPTAQIAVMGASGAVGFVYRKQLQQAAKDGADVDALRLELQNEYEDTLVNPYVAAERGYVDAVIPPSHTRGQIVSALRLLERKMVTLPPKKHGNIPL GT:EXON 1|1-546:0| BL:SWS:NREP 1 BL:SWS:REP 17->546|PCC5_MYCTU|0.0|83.5|528/548| NREPEAT 1 REPEAT 2|57->190|313->432| SEG 5->15|qqqsasgsags| SEG 286->301|iedsltdedleldtii| BL:PDB:NREP 1 BL:PDB:REP 17->546|2a7sA|0.0|83.5|528/529| RP:PDB:NREP 1 RP:PDB:REP 17->546|2a7sA|3e-90|80.5|528/529| RP:PFM:NREP 1 RP:PFM:REP 52->528|PF01039|e-119|53.5|447/454|Carboxyl_trans| HM:PFM:NREP 1 HM:PFM:REP 46->544|PF01039|4.1e-202|53.5|488/493|Carboxyl_trans| GO:PFM:NREP 1 GO:PFM GO:0016874|"GO:ligase activity"|PF01039|IPR000022| RP:SCP:NREP 2 RP:SCP:REP 20->269|1on3A1|1e-88|50.2|249/253|c.14.1.4| RP:SCP:REP 272->545|1on3A2|3e-80|51.3|261/264|c.14.1.4| HM:SCP:REP 17->276|2a7sA1|1.7e-81|42.0|257/0|c.14.1.4|1/2|ClpP/crotonase| HM:SCP:REP 283->546|1od2A2|4e-97|43.9|264/389|c.14.1.4|2/2|ClpP/crotonase| OP:NHOMO 1868 OP:NHOMOORG 881 OP:PATTERN --1-1111111111111------132231-23----------------------1111111-----11 3454935444532277755-583378555555887876B927461223111123222211566234455531111111-11131-111333313111--2222333233311111111111111-122321222214556611132111111111111-1111-111111-1111111111-1223221-113322222222222222233333322234342--1111112-111111111111111111111------1-----11--11-1--11111111111111111111111111111111111111-111111111221111111111112111-111211--2312111212112211121121311533511111127553325766533333322232-22422322344-222321322333223332222222324--------1----2441111111111-111111111111111111-4322-132122222222111122232222-222456541133133323424458123----31----------2242943-----------32332121244443321111-1111111111111111-1111--11-23-1131-1111111111112111111---1---------1-1-1-------------------------------1111111-------------------1--------111111111111--11111112333-22--111---11111----33333113112-44441543422222222-------------2-----12-113232322222----1111221122----------1-------------------------1111111111121 ----222-721-225222232212213222211122222222222221111131111111111--------------------------1222211222-114444-2425343532222232-44331KK2-334221232215222226224264453652532111132344322-E1112211122122232224 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 530 STR:RPRED 97.1 SQ:SECSTR ################cTTcHHHHHHHHHHHHHHTTcTTcHHHHHHHHHTTcccHHHHHHHHccTTccEEEcTTcccccccTTcTTcccTTTTEEEEEEEccccEEEEEEEcTTcGGGcccHHHHHHHHHHHHHHHHHTccEEEEEccccccGGGcTHHHHHHHHHHHHHHHHTTTccEEEEEccccccGGGHHHHHccEEEEEcTTcccccccHHHHHHHHcccccHHHHHcHHHHHHTcccccEEEccHHHHHHHHHHHHHHccccTTccccccccccccccGGGGcccHHHHTTTTTccccccccccTHHHHHHcHcccccEEEcTTccTTEEEEEEEccccEEEEEEEcTTTGGGcccHHHHHHHHHHHHHHHHTTccEEEEEEEccccccHHHHHHcHHHHHHHHHHHHHHccccEEEEEEEEEEHHHHHHTTcGGGTccEEEEcTTcEEEcccHHHHHHHHTTTTTTGGGTccccTTccTTHHHHHHHTTTcccHHHHHHTcccEEccGGGHHHHHHHHHHHTTTccccccccccccccc DISOP:02AL 1-16, 473-481| PSIPRED cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccccccccHHHHHHHHHcccccccccccccccccccccccccccccEEEEEEEEEccEEEEEEEEccccccccccHHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHccEEEEEEcccEEEEEcHHHHHHHHccccccccccHHHHHHHHccEEEEEEccHHHHHHHHHHHHHHccccccccccEEEccccHHHcccccccccccHHHHcccccccccccHHHHHHHHccccccEEEccccccEEEEEEEEEccEEEEEEEEccHHHcccccHHHHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHcccccccEEEEccccEEEEEcHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHHHHHccccccccHHHHHHHHHHHHHHHHHccccccccccccccc //