[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55841.1
DDBJ      :             putative membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  32/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:167 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   86->147 PF03703 * DUF304 1e-06 29.0 %
:HMM:PFM   81->153 PF03703 * DUF304 8.5e-19 35.6 73/80  
:HMM:PFM   29->82 PF02990 * EMP70 0.00012 24.1 54/521  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55841.1 GT:GENE BAD55841.1 GT:PRODUCT putative membrane protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1103066..1103569 GB:FROM 1103066 GB:TO 1103569 GB:DIRECTION + GB:PRODUCT putative membrane protein GB:PROTEIN_ID BAD55841.1 LENGTH 167 SQ:AASEQ MGYPEDVLAPDEHLILHRHPHWKMLFWPIVTLIVATALAGFAGGLAYRTTEGTLRTALLILVPALWAVVVVWRVVAPVLAWKSTHFIVTERRVLVRQGVVTHTGIDIPMSRISSVQFRHGLFDRLLGTGTLIIGSSSEEPMEYDDIPAVQKVHALLYYQVFEAQREH GT:EXON 1|1-167:0| TM:NTM 2 TM:REGION 23->45| TM:REGION 56->78| SEG 35->46|atalagfaggla| SEG 57->81|allilvpalwavvvvwrvvapvlaw| RP:PFM:NREP 1 RP:PFM:REP 86->147|PF03703|1e-06|29.0|62/78|DUF304| HM:PFM:NREP 2 HM:PFM:REP 81->153|PF03703|8.5e-19|35.6|73/80|DUF304| HM:PFM:REP 29->82|PF02990|0.00012|24.1|54/521|EMP70| OP:NHOMO 32 OP:NHOMOORG 32 OP:PATTERN -------------------------------------------------------------------- ----1---------11111-1111111-1111111111111--1----------------1-1-111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 164-167| PSIPRED ccccccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccEEEEEEEEEEEEEEccEEEcccEEEEHHHHccccccccHHHHHHcccEEEEEccccccEEEcccHHHHHHHHHHHHHHHcccccc //