[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55844.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  48/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:180 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   27->111 PF04138 * GtrA 2e-07 31.3 %
:HMM:PFM   27->157 PF04138 * GtrA 1.1e-25 27.4 117/117  
:BLT:SWISS 4->36 DXS1_JANSC 3e-04 57.6 %
:BLT:SWISS 26->114 Y3818_MYCBO 2e-05 25.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55844.1 GT:GENE BAD55844.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1105573..1106115) GB:FROM 1105573 GB:TO 1106115 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55844.1 LENGTH 180 SQ:AASEQ MSIADDAVSVLPEPLREIAYRHHELIKFAIVGATTFVIDSGIFYALKWTVLTEKPVTAKIISGVVAVIASYVLNREWSFKNRGGRERHHEALLFFVVSGIGVALSNIPLWISSYVFDLRQPAVSFTVENIADFVSAFIIGNLLQMAFRFWAMRRWVFPDEMGELEAELEELMEEEQLGRS GT:EXON 1|1-180:0| BL:SWS:NREP 2 BL:SWS:REP 4->36|DXS1_JANSC|3e-04|57.6|33/639| BL:SWS:REP 26->114|Y3818_MYCBO|2e-05|25.0|88/121| TM:NTM 4 TM:REGION 28->50| TM:REGION 55->76| TM:REGION 92->114| TM:REGION 131->152| SEG 160->178|emgeleaeleelmeeeqlg| RP:PFM:NREP 1 RP:PFM:REP 27->111|PF04138|2e-07|31.3|83/116|GtrA| HM:PFM:NREP 1 HM:PFM:REP 27->157|PF04138|1.1e-25|27.4|117/117|GtrA| GO:PFM:NREP 3 GO:PFM GO:0000271|"GO:polysaccharide biosynthetic process"|PF04138|IPR007267| GO:PFM GO:0006810|"GO:transport"|PF04138|IPR007267| GO:PFM GO:0016021|"GO:integral to membrane"|PF04138|IPR007267| OP:NHOMO 56 OP:NHOMOORG 48 OP:PATTERN -------------------------------------------------------------------- ----1----------1111-11111111111111113311111111--111-1-1211--211-1212--1----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 178-180| PSIPRED ccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHcccc //