[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55847.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  58/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
c.120.1
:185 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   16->173 3bleA PDBj 2e-04 16.6 %
:HMM:SCOP  1->127 2h1cA1 c.120.1.1 * 6.1e-05 26.7 %
:HMM:PFM   148->178 PF02082 * Rrf2 0.00011 35.5 31/83  
:HMM:PFM   34->114 PF01850 * PIN 0.0002 24.7 77/126  

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55847.1 GT:GENE BAD55847.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1107894..1108451) GB:FROM 1107894 GB:TO 1108451 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55847.1 LENGTH 185 SQ:AASEQ MPFIALYDANVLYGNTLRDMLIRLARSGVVQAKWTDAILDETMRTLAAKRPDIAESKLNRLRELIVAAVPDCLVEGYEPLIAGLRLPDPDDRHVLAAAIKAGAQVIVTANLADFPAAQLRQWDIEARGPDEFVLDQVHLDDRVVWACVQQIADSRRNPPETVDDVLEALESAGLVESVAALRTGR GT:EXON 1|1-185:0| RP:PDB:NREP 1 RP:PDB:REP 16->173|3bleA|2e-04|16.6|151/307| HM:PFM:NREP 2 HM:PFM:REP 148->178|PF02082|0.00011|35.5|31/83|Rrf2| HM:PFM:REP 34->114|PF01850|0.0002|24.7|77/126|PIN| HM:SCP:REP 1->127|2h1cA1|6.1e-05|26.7|116/0|c.120.1.1|1/1|PIN domain-like| OP:NHOMO 65 OP:NHOMOORG 59 OP:PATTERN -------------------------------------------------------------------- 2--1--------------------------------1-22--1------------1-------------------1-----------------------------------------------------------------------2----1-------------1-------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------1--------------------1-------2--111----------1111111111--------1-----1--------------------------------1----1111-------------------1-------1--------2--11--1-1---1-------------------------------------------------------------------------11----1-------1---------------------------------1----------------------------------------1--------------------------------------------------11-1-1------------------------------1---1-1-----------------------------------------------1-------------------------------------------------------- --------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 151 STR:RPRED 81.6 SQ:SECSTR ###############HHHHHTTcTTccccHHHHHHHHHHHTTccEEEEEETTccTTHHHHHHH#HHHHHHHT######TcGGGEEEEEEccTHHHHHHHHHTccEEEEEEEccHHHHHTcccHHHHHHHHHHHHHHHHHTTcEEEEEEETHHHHHHHcHHHHHHHHHHHHTcc############ DISOP:02AL 185-186| PSIPRED ccEEEEEHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHccccccccccHHccccccccccHHHHHHHHHHccccEEEEccHHHccHHHHHHcccccccHHHHHHHHHcccHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccHHHHHHHHccc //