[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55848.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  61/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:155 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   81->108 PF09107 * SelB-wing_3 6.9e-05 39.3 28/50  
:BLT:SWISS 68->149 Y2337_MYCBO 4e-12 40.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55848.1 GT:GENE BAD55848.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1108451..1108918) GB:FROM 1108451 GB:TO 1108918 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55848.1 LENGTH 155 SQ:AASEQ MCAMSPTHAAKRIEPGTIDAELAARAMRRIKDYLVKHPAEETVPVTAETGPDEPLVLPRAVVDMVAFILAQAAAGRGVSLVPSNAELTTQQAADILNVSRPYVVGLLESGEIPFRLVGTHRRIRFDDLKEYQRRSEGHSRAAADELSDLGQELGI GT:EXON 1|1-155:0| BL:SWS:NREP 1 BL:SWS:REP 68->149|Y2337_MYCBO|4e-12|40.2|82/114| HM:PFM:NREP 1 HM:PFM:REP 81->108|PF09107|6.9e-05|39.3|28/50|SelB-wing_3| OP:NHOMO 74 OP:NHOMOORG 61 OP:PATTERN -------------------------------------------------------------------- 2--1-11----------22-2-----22222-----1123--1-11-1--------1------------------1-----------------------------------------------------------------------2------------------1-------------------11--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------1-----1-------------1------1------------1----------------------------1-----1--------------------------------1-------------------11--------1-----1----1---1--11--1-1---1-------------------------------------------------------------------------11----1-------1---------------------------------1---------------------------------------11--------------------------------------------------11-1-1------------------------------1---1-1-----------------------------------------------1-------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 134-146| PSIPRED ccccccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEccHHHHHHHHHHHHHHHccccEEEEcccccccHHHHHHHHcccHHHHHHHHHcccccEEEcccEEEEcHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //