[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55851.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  52/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
d.108.1
:99 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   11->81 3d2pA PDBj 1e-04 15.5 %
:RPS:SCOP  5->97 1r57A  d.108.1.1 * 4e-23 16.3 %
:HMM:SCOP  6->98 1xmtA_ d.108.1.1 * 2.7e-24 44.4 %
:HMM:PFM   21->76 PF00583 * Acetyltransf_1 2.4e-08 26.8 56/83  
:BLT:SWISS 1->99 GTL3B_XENTR 4e-07 27.3 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55851.1 GT:GENE BAD55851.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1111086..1111385) GB:FROM 1111086 GB:TO 1111385 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55851.1 LENGTH 99 SQ:AASEQ MHPIMTTRLEHNAADTRYEIYVDDTLAGYADYAEREDAKVRDFHHTITFPEFRGQGIAGKVVEYALDDTRAAGFTVVPTCWYVEKFIAEHREYADLLAP GT:EXON 1|1-99:0| BL:SWS:NREP 1 BL:SWS:REP 1->99|GTL3B_XENTR|4e-07|27.3|99/109| RP:PDB:NREP 1 RP:PDB:REP 11->81|3d2pA|1e-04|15.5|71/424| HM:PFM:NREP 1 HM:PFM:REP 21->76|PF00583|2.4e-08|26.8|56/83|Acetyltransf_1| RP:SCP:NREP 1 RP:SCP:REP 5->97|1r57A|4e-23|16.3|92/102|d.108.1.1| HM:SCP:REP 6->98|1xmtA_|2.7e-24|44.4|90/0|d.108.1.1|1/1|Acyl-CoA N-acyltransferases (Nat)| OP:NHOMO 66 OP:NHOMOORG 53 OP:PATTERN -------------------------------------------------------------------- ----1111222111111----1--12------21113322-1--1111-11-111-2-----21--1-111----------------------------------------------------------------------------------------------------------------111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----1----------------------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------111---------------1--------------------------------------------------------------------------------------------------1- -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 74 STR:RPRED 74.7 SQ:SECSTR #######HHHTTTGGGEEEEEETTEEEEEEEEEEcccTTcEEEEEEEEcGGGccccHHHHHHHHHHHHHHTTTccEEEEEE################## DISOP:02AL 1-4, 94-95| PSIPRED ccccccEEEEEcccccEEEEEEccEEEEEEEEEEEcccEEEEEEEEEEccccccccHHHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHcccccccccc //