[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55853.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:102 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55853.1 GT:GENE BAD55853.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1112979..1113287 GB:FROM 1112979 GB:TO 1113287 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55853.1 LENGTH 102 SQ:AASEQ MRTEGPDLDLVAAVFADDLGDTAVDLDTLRRIHAGEFGPWAAALEGSGLFDKQALERIVGRWRRDPRTLLDALLADADDVTRRRWAMAWSALERPEPVSRIG GT:EXON 1|1-102:0| SEG 7->21|dldlvaavfaddlgd| SEG 69->79|lldalladadd| OP:NHOMO 6 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-32----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-4, 99-102| PSIPRED cccccccHHHHHHHHHHccccccccHHHHHHHHcccccHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHcHHHHHHHHHHHHHHHccccccccccc //