[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55854.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  6/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:155 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   40->153 PF04138 * GtrA 3.9e-16 26.3 114/117  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55854.1 GT:GENE BAD55854.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1113356..1113823 GB:FROM 1113356 GB:TO 1113823 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55854.1 LENGTH 155 SQ:AASEQ MPAAVTTENLADRFSAWCAAVVRRLPWGLDRIVAPTFLGFALINSGTFGLDLLLLTAMHGGLGWPLPVAISIAYACAFGVAFVLNRTLNFHSHAPVGRQLVVYVVVVVVNYLAFILGVGSGLAAAGLDYHLARLVAGGCEAIYMYSAMRWIVFRR GT:EXON 1|1-155:0| TM:NTM 3 TM:REGION 33->55| TM:REGION 64->86| TM:REGION 97->119| SEG 101->109|vvyvvvvvv| SEG 116->127|lgvgsglaaagl| HM:PFM:NREP 1 HM:PFM:REP 40->153|PF04138|3.9e-16|26.3|114/117|GtrA| OP:NHOMO 6 OP:NHOMOORG 6 OP:PATTERN -------------------------------------------------------------------- ----1---------------------------1---1----------1---------------1--1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3| PSIPRED ccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcc //