[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55855.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  8/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.23.16
:212 amino acids
:PSIPRED
:HMM:SCOP  12->212 1fyeA_ c.23.16.4 * 1.7e-12 25.3 %
:RPS:PFM   60->206 PF03575 * Peptidase_S51 1e-08 31.9 %
:HMM:PFM   53->207 PF03575 * Peptidase_S51 4e-21 27.3 143/153  
:BLT:SWISS 1->211 Y1070_DEIRA 1e-11 32.6 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55855.1 GT:GENE BAD55855.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1113867..1114505) GB:FROM 1113867 GB:TO 1114505 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55855.1 LENGTH 212 SQ:AASEQ MRLFLASYRFGRHAQRLARLVGGPGRVAVVPNACDAWPSAWQAAVTSDLVPLRRAGYAPEVVDLRDHLGQPAALERRLREFPLLWVRGGNTFVLRAQFARSGADRVIPALLAEDRLAYAGYSAGACVLTPDLHGLDVVDDPQEVVTACGVAPRWDGLGLVPYRIVPHLDSPTDPDGACRRIAEKYRTAGVPHHALTDDEVLVVDGDEFERLG GT:EXON 1|1-212:0| BL:SWS:NREP 1 BL:SWS:REP 1->211|Y1070_DEIRA|1e-11|32.6|193/199| RP:PFM:NREP 1 RP:PFM:REP 60->206|PF03575|1e-08|31.9|135/150|Peptidase_S51| HM:PFM:NREP 1 HM:PFM:REP 53->207|PF03575|4e-21|27.3|143/153|Peptidase_S51| GO:PFM:NREP 2 GO:PFM GO:0006508|"GO:proteolysis"|PF03575|IPR005320| GO:PFM GO:0008236|"GO:serine-type peptidase activity"|PF03575|IPR005320| HM:SCP:REP 12->212|1fyeA_|1.7e-12|25.3|170/0|c.23.16.4|1/1|Class I glutamine amidotransferase-like| OP:NHOMO 8 OP:NHOMOORG 8 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1111----1--------------------------------------------------------------------------------------------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- PSIPRED cEEEEEccccHHHHHHHHHHcccccEEEEEccccccccccccHHHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHccEEEEccccHHHHHHHHHHccHHHHHHHHHHccccEEEEccccHHHHccccccccccccHHHccccEEEccccccccccccEEEcccccccccccHHHHHHHHHHcccccEEEcccccEEEEEccEEEEcc //