[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55856.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  24/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.213.1
:279 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:RPS:PDB   17->123 3di5A PDBj 2e-06 10.6 %
:RPS:PDB   194->267 3bn8A PDBj 9e-04 13.7 %
:RPS:SCOP  21->163 2nsfA1  a.213.1.4 * 1e-12 17.9 %
:HMM:SCOP  5->166 1rxqA_ a.213.1.1 * 1.3e-11 23.2 %
:RPS:PFM   25->56 PF11716 * MDMPI_N 2e-04 59.4 %
:HMM:PFM   15->160 PF11716 * MDMPI_N 2.2e-39 32.9 140/140  
:HMM:PFM   176->267 PF07398 * MDMPI_C 7.6e-11 28.2 78/82  
:BLT:SWISS 22->163 Y037_MYCBO 4e-07 31.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55856.1 GT:GENE BAD55856.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1114509..1115348) GB:FROM 1114509 GB:TO 1115348 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55856.1 LENGTH 279 SQ:AASEQ MNDPTLAKDELVPLLSEQWTAIDRLVADLDEPAWRQPSPLPGWTVFDVVAHVVGTESWLLGEKPPPHDPVRPKTDVRALPHVRNETAVLNEIWIDRLRPMPGHRLLALFREVADRRRAALADKTDAEWATPTVSPIGQVPYGRFMRVRLFDCWMHELDIADALGVRVAEGGRRGEVAFAEFAGSLPRVVAKLGKAPAGSRIAFVLTGELARTLRIEVGERAAFVERFAEPAGVEITLDSGLFVRLGGGRTPIEDHLGDVDITGDEQLGLQVVRNLAFTI GT:EXON 1|1-279:0| BL:SWS:NREP 1 BL:SWS:REP 22->163|Y037_MYCBO|4e-07|31.0|126/257| SEG 164->177|gvrvaeggrrgeva| RP:PDB:NREP 2 RP:PDB:REP 17->123|3di5A|2e-06|10.6|104/144| RP:PDB:REP 194->267|3bn8A|9e-04|13.7|73/110| RP:PFM:NREP 1 RP:PFM:REP 25->56|PF11716|2e-04|59.4|32/127|MDMPI_N| HM:PFM:NREP 2 HM:PFM:REP 15->160|PF11716|2.2e-39|32.9|140/140|MDMPI_N| HM:PFM:REP 176->267|PF07398|7.6e-11|28.2|78/82|MDMPI_C| RP:SCP:NREP 1 RP:SCP:REP 21->163|2nsfA1|1e-12|17.9|134/160|a.213.1.4| HM:SCP:REP 5->166|1rxqA_|1.3e-11|23.2|142/174|a.213.1.1|1/1|DinB/YfiT-like putative metalloenzymes| OP:NHOMO 24 OP:NHOMOORG 24 OP:PATTERN -------------------------------------------------------------------- --------------1-111-1---1-11111111111111----------------------1----111----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 205 STR:RPRED 73.5 SQ:SECSTR #############HHHHHHHHHHHHHHHccTTGGGccccTTcccHHHHHHHHHHHHHHHGGGTcccccccccc###cccccHHHHHHHHHHHHHHHHHHHHHHccGGGGGcEEEETTEEEHHHcTTGGGcE#######EEEHHHHcEEEHHHHHH######################################HHTccEEEEEEETTEEEEEEEcTTc#cEEEEEcccccccEEEEccHHHHHHHHTTcccHHHHHTccEEEccHHH############ DISOP:02AL 1-4| PSIPRED cccccccHHHHHHHHHHHHHHHHHHHHcccHHHHccccccccccHHHHHHHHHHHHHHHHccccccHHHcccccccccHHHHccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEcccccEEEEEEcccEEEccccccccEEEEEEcHHHEEEEccccccHHHHcccccccccHHHHHHHHHHHHHcc //