[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55857.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  57/68 : Bacteria  760/915 : Eukaryota  169/199 : Viruses  0/175   --->[See Alignment]
d.13.1
:150 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   7->110 1y23C PDBj 4e-23 46.6 %
:RPS:SCOP  7->114 1av5A  d.13.1.1 * 4e-29 32.7 %
:HMM:SCOP  6->145 1y23A_ d.13.1.1 * 3.7e-39 43.2 %
:RPS:PFM   19->113 PF01230 * HIT 2e-23 55.3 %
:HMM:PFM   18->112 PF01230 * HIT 1.7e-28 45.7 94/98  
:BLT:SWISS 8->129 YHI2_MYCTU 6e-30 51.2 %
:PROS 91->109|PS00892|HIT_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55857.1 GT:GENE BAD55857.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1115345..1115797) GB:FROM 1115345 GB:TO 1115797 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55857.1 LENGTH 150 SQ:AASEQ MVAGVNDCVFCRIVAGAAPATKVYEDETLCAFLDIRPIARGHTLVIPKRHAAGLPDLDPELGAAMFRAAHRIALAMRRGGLAADGANLVLNDGRAAFQTVGHVHLHVIPRRDGDRIRFATGFLLRRPHDPGATAAAIRAGLTALEEGTQP GT:EXON 1|1-150:0| BL:SWS:NREP 1 BL:SWS:REP 8->129|YHI2_MYCTU|6e-30|51.2|121/144| PROS 91->109|PS00892|HIT_1|PDOC00694| SEG 131->144|gataaairagltal| BL:PDB:NREP 1 BL:PDB:REP 7->110|1y23C|4e-23|46.6|103/138| RP:PFM:NREP 1 RP:PFM:REP 19->113|PF01230|2e-23|55.3|94/97|HIT| HM:PFM:NREP 1 HM:PFM:REP 18->112|PF01230|1.7e-28|45.7|94/98|HIT| RP:SCP:NREP 1 RP:SCP:REP 7->114|1av5A|4e-29|32.7|107/113|d.13.1.1| HM:SCP:REP 6->145|1y23A_|3.7e-39|43.2|139/0|d.13.1.1|1/1|HIT-like| OP:NHOMO 1279 OP:NHOMOORG 986 OP:PATTERN 11-11-11111111121111111-11111111---11111111-111-11111-111111-122-222 111221-1------31111-12--12122221222233221-2111211111---121--21211231-1-1111111-112-112111111-111---111111111----------1------21111111111111111111211--11-1122111111111-2221-1-----1--1----11--1111222221121213211222211221111111111111112111111111111111111111121221111122111111211212211111111111111111111111111111111111111111111111112223333131111111111111121112212111211111111--311211111111111112111111111111111111-12111111111111111111111111111-11-----1111111111---1111-111---------------------1----11111122212222222222222222222212222222211-11111222212111112111111111111111212-11111---21111112111111211112422111111111111-1111111111111111-111-111------21-----111------11111------21111111111111111-111111111111111111111111112122222222112222211111111--111111111111---111111111111111---111-1111-11111111111111-33331211211111111111111111-1111111111111111111111111111211111111111111111--111111-1111111---11111111112-11-------- --11311-211112-2211111112-11112-21121323333112111-1111111-12-2111111-111111-1---11111111-44523221111223231-23-321211-2-2111-44-11131-22221-131322222211--1-22-1--112111226222412121E11-1112361222231111 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 113 STR:RPRED 75.3 SQ:SECSTR ####ccccHHHHHHHTcccccEEEEcccEEEEEcTTcccTTcEEEEEccccccGGGccHHHHHHHTTHHHHHHHHHHHHHHcccEEEEEEcccGGGTcccccccEEEEEEccccccc################################# DISOP:02AL 1-3, 145-150| PSIPRED ccccccccccccccccccccEEEEEccEEEEEEcccccccEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEccccccccEEEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHccccccc //