[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55861.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:79 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   45->73 PF00542 * Ribosomal_L12 1.5e-05 42.9 28/68  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55861.1 GT:GENE BAD55861.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1118998..1119237) GB:FROM 1118998 GB:TO 1119237 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55861.1 LENGTH 79 SQ:AASEQ MFGNDRLEHRLARVERKLDLILAHLGLEDPRSVEGLAEVDALVRAGKKIEAVKKYRQVDPGAGLGEAVAAVEERARGNR GT:EXON 1|1-79:0| SEG 61->77|gaglgeavaaveerarg| HM:PFM:NREP 1 HM:PFM:REP 45->73|PF00542|1.5e-05|42.9|28/68|Ribosomal_L12| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-7, 72-79| PSIPRED ccccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccHHHHHHHHHHHccccccHHHHHHHHHHHHcccc //