[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55865.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  13/68 : Bacteria  194/915 : Eukaryota  1/199 : Viruses  0/175   --->[See Alignment]
a.4.5d.58.4
:164 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   32->146 2znzC PDBj 1e-14 30.4 %
:RPS:PDB   26->156 2e1cA PDBj 3e-17 28.2 %
:RPS:SCOP  26->70 1i1gA1  a.4.5.32 * 1e-05 28.9 %
:RPS:SCOP  71->156 1ri7A2  d.58.4.2 * 2e-18 30.2 %
:HMM:SCOP  9->71 2cg4A1 a.4.5.32 * 1.8e-11 31.7 %
:HMM:SCOP  71->156 1ri7A2 d.58.4.2 * 1.6e-21 38.4 %
:RPS:PFM   86->145 PF01037 * AsnC_trans_reg 1e-09 50.0 %
:HMM:PFM   77->147 PF01037 * AsnC_trans_reg 1e-20 40.8 71/74  
:HMM:PFM   18->58 PF08279 * HTH_11 7e-07 30.8 39/55  
:BLT:SWISS 32->146 REG6_PYRHO 3e-14 30.4 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55865.1 GT:GENE BAD55865.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1121835..1122329) GB:FROM 1121835 GB:TO 1122329 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD55865.1 LENGTH 164 SQ:AASEQ MPSTEQVEATLDATDARLLLELIATPRATGVELATRLGLSRNTVQARLARWEATGMLASVERRVRPRALGYPLAAFVSVVLDQHRLDAVVDALAEIPEVTEVCGMTGRVDLTVRVVARDAEDLYRLAEEILQIPGVERTDMALVMRELVGPRTAPLLERLAGTG GT:EXON 1|1-164:0| BL:SWS:NREP 1 BL:SWS:REP 32->146|REG6_PYRHO|3e-14|30.4|115/151| SEG 8->22|eatldatdarlllel| BL:PDB:NREP 1 BL:PDB:REP 32->146|2znzC|1e-14|30.4|115/144| RP:PDB:NREP 1 RP:PDB:REP 26->156|2e1cA|3e-17|28.2|131/147| RP:PFM:NREP 1 RP:PFM:REP 86->145|PF01037|1e-09|50.0|60/74|AsnC_trans_reg| HM:PFM:NREP 2 HM:PFM:REP 77->147|PF01037|1e-20|40.8|71/74|AsnC_trans_reg| HM:PFM:REP 18->58|PF08279|7e-07|30.8|39/55|HTH_11| GO:PFM:NREP 4 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01037|IPR019887| GO:PFM GO:0005622|"GO:intracellular"|PF01037|IPR019887| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01037|IPR019887| GO:PFM GO:0043565|"GO:sequence-specific DNA binding"|PF01037|IPR019887| RP:SCP:NREP 2 RP:SCP:REP 26->70|1i1gA1|1e-05|28.9|45/60|a.4.5.32| RP:SCP:REP 71->156|1ri7A2|2e-18|30.2|86/86|d.58.4.2| HM:SCP:REP 9->71|2cg4A1|1.8e-11|31.7|63/0|a.4.5.32|1/1|"Winged helix" DNA-binding domain| HM:SCP:REP 71->156|1ri7A2|1.6e-21|38.4|86/0|d.58.4.2|1/1|Dimeric alpha+beta barrel| OP:NHOMO 371 OP:NHOMOORG 208 OP:PATTERN ----1-----------1--------11---1-----1-----------------2121111------- ----4------1--4------1--11111111--1-22871---3111----445122--211-422253------------------2211-------1-2111111-1-----------------------------------1---1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------2221-----111--------1-111-1-1-11----2--1-------11111211233--1-12132222332--------1-----13-------------------------------12--211234334343322244113333233512224-----112331-3-31--2----4-----------111------1--------1-------------------------------------------111------11---------------------1-----------------------------------------------------1-----------------1------------------------1-------------2111--------1---2222211---1-111122-3132321----------------------11---1111111111--------------------------------------------------------------- -------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 135 STR:RPRED 82.3 SQ:SECSTR ######################HTHTTccHHHHHHHHTccHHHHHHHHHHHHHTTccccccccccGGGGTccEEEEEEEEEcTTcHHHHHHHHHTcTTEEEEEEccccccEEEEEEEccHHHHHHHHHHHHHcTTEEEEEEEEcccccccccccccc####### DISOP:02AL 1-12, 160-164| PSIPRED ccccccccccccHHHHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHcccEEEEEEEEcHHHHcccEEEEEEEEEccccHHHHHHHHHccccEEEEEEEcccccEEEEEEEccHHHHHHHHHHHHHccccEEEEEEEEEEEEEcccccccHHHccccc //