[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55874.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:103 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 19->103 RL3_PLARO 8e-04 29.6 %
:TM

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55874.1 GT:GENE BAD55874.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1131535..1131846 GB:FROM 1131535 GB:TO 1131846 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55874.1 LENGTH 103 SQ:AASEQ MPGERRPAIGVIRPDLLRGKQIDLTAIAGPDFRLVFTVFLDAGPMLTALAIARHLDEFAAAAVVTPGLEHVDPVRHVVTDLADLVTPSRVYPRGYRWPEREDE GT:EXON 1|1-103:0| BL:SWS:NREP 1 BL:SWS:REP 19->103|RL3_PLARO|8e-04|29.6|81/100| TM:NTM 1 TM:REGION 32->54| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 98-103| PSIPRED ccccccccccccccHHHcccccEEEEEcccccEEHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHccccccccccccccccccc //