[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55878.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  77/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.92.2
:289 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   52->149 2qi9F PDBj 3e-09 37.1 %
:RPS:PDB   27->288 2chuB PDBj 2e-14 12.7 %
:RPS:SCOP  52->256 1n2zA  c.92.2.2 * 2e-21 21.5 %
:HMM:SCOP  51->284 1n2zA_ c.92.2.2 * 5.4e-27 26.4 %
:RPS:PFM   55->159 PF01497 * Peripla_BP_2 2e-05 33.7 %
:HMM:PFM   76->210 PF01497 * Peripla_BP_2 2.1e-06 21.5 135/238  
:BLT:SWISS 53->153 BTUF_PECCP 1e-09 34.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55878.1 GT:GENE BAD55878.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1136947..1137816 GB:FROM 1136947 GB:TO 1137816 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55878.1 LENGTH 289 SQ:AASEQ MCGAGRDRRNVPALPRRCPNTAPGPYASPKLAQVTAVIRDDLGAEVPLSAPARRVVSLVPSLTEAVAHTCPETLVAATRWCTHPAELAVERLRGTKNPDVRRIVALAPDLVLCNQEENRRLDVDRLRAAGVPVWVTRIETLAEAVASLARLFTTAFGHEVPAWLAEAENAWAAPPPRPPIPAVIPVWRNPWMVVGRDTFTGDLAARLGLHLVHAERPERYPTLTDADLTRGVDLAVLPDEPYVFTADDGPDAFPGIPVALVEGRALTWYGPSLTTARSHLTARIEAAIG GT:EXON 1|1-289:0| BL:SWS:NREP 1 BL:SWS:REP 53->153|BTUF_PECCP|1e-09|34.7|101/276| SEG 161->188|pawlaeaenawaappprppipavipvwr| BL:PDB:NREP 1 BL:PDB:REP 52->149|2qi9F|3e-09|37.1|97/243| RP:PDB:NREP 1 RP:PDB:REP 27->288|2chuB|2e-14|12.7|260/283| RP:PFM:NREP 1 RP:PFM:REP 55->159|PF01497|2e-05|33.7|104/235|Peripla_BP_2| HM:PFM:NREP 1 HM:PFM:REP 76->210|PF01497|2.1e-06|21.5|135/238|Peripla_BP_2| GO:PFM:NREP 2 GO:PFM GO:0005381|"GO:iron ion transmembrane transporter activity"|PF01497|IPR002491| GO:PFM GO:0006827|"GO:high-affinity iron ion transport"|PF01497|IPR002491| RP:SCP:NREP 1 RP:SCP:REP 52->256|1n2zA|2e-21|21.5|195/245|c.92.2.2| HM:SCP:REP 51->284|1n2zA_|5.4e-27|26.4|227/0|c.92.2.2|1/1|"Helical backbone" metal receptor| OP:NHOMO 83 OP:NHOMOORG 78 OP:PATTERN -----------------------------------------------1-------------------- ----1-------------------------------1----111----------------11-111-1111-----------1----------------1-111-11-11--------------------------11111---2--------------------------------------1------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------1-----------------1-----------------------------------------------------------------------------------------------------------------------------------1111111111111111111111112222--111-----------111-----1---------1111-----1-----------------------11--------------------------------------------------------------1-1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 263 STR:RPRED 91.0 SQ:SECSTR ##########################cEEEEcccEEEEEcccccEEEEEcccccEEEccHHHHHHHHcGGGEEEccGGGccGGGGGGTcccccccccccHHHHHHTcccEEEEcTTTGGGHHHHHHTTccEEEccccTTcHHHHHHHHHHHHHHTTTcHHHHHHHHHHHHHHHTccTTcEEEEEEEETTEEEEEcTTcTTTHHHHTTccEEccccccccEEEcHHHHHHHcccEEEEEEHHHHHTccccHHHHTccHEEEEcHHHHTTTTTccHHHHHHHHHHHHHHHc DISOP:02AL 1-6| PSIPRED cccccccccccHHHHHHccccccccccccccccccEEEEEccccEEEEcccccEEEEcccHHHHHHHHcccccEEEEEcHHcccHHHccccccccccccHHHHHHccccEEEEEcccccHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEccccEEEEccccHHHHHHHHHcccccHHHcccccccccHHHHHHcccEEEEEccccccccccHHHHcccccEEEEccHHHHcccccHHHHHHHHHHHHHHHcc //