[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55885.1
DDBJ      :             putative 3-hydroxyisobutyrate dehydrogenase
Swiss-Prot:             

Homologs  Archaea  24/68 : Bacteria  523/915 : Eukaryota  172/199 : Viruses  0/175   --->[See Alignment]
a.100.1c.2.1
:299 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   5->290 2gf2D PDBj 2e-48 38.5 %
:RPS:PDB   4->286 3ckyC PDBj 7e-55 32.9 %
:RPS:SCOP  4->160 1vpdA2  c.2.1.6 * 8e-29 31.2 %
:RPS:SCOP  162->286 3cumA1  a.100.1.1 * 4e-23 36.0 %
:HMM:SCOP  2->165 1pgjA2 c.2.1.6 * 9.9e-47 41.1 %
:HMM:SCOP  162->298 2cvzA1 a.100.1.1 * 1.4e-30 41.2 %
:RPS:PFM   4->160 PF03446 * NAD_binding_2 2e-19 38.9 %
:HMM:PFM   3->160 PF03446 * NAD_binding_2 3.9e-52 44.3 158/163  
:BLT:SWISS 5->294 MMSB_MYCTU 2e-70 53.4 %
:PROS 7->20|PS00895|3_HYDROXYISOBUT_DH
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55885.1 GT:GENE BAD55885.1 GT:PRODUCT putative 3-hydroxyisobutyrate dehydrogenase GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1147707..1148606 GB:FROM 1147707 GB:TO 1148606 GB:DIRECTION + GB:PRODUCT putative 3-hydroxyisobutyrate dehydrogenase GB:PROTEIN_ID BAD55885.1 LENGTH 299 SQ:AASEQ MSKKIGFLGLGHMGAPMAANLVKAGHDVLAYDPVPAAQEQARADGATVVATAAEAAAGREIVITMLPNGKLVLDVYAELLPAAAPGTLFIDCSTIDVADAKAAAERAVAAGHRALDAPVSGGVAGAAAGTLTFMVGGAADDFAAALPVLEVMGGKVVHCGGAGVGQAAKICNNMLLGISMIALSEALVLGEKLGLSHQSFFDVVSTASGQSWALTSYCPVPGPVPTSPANNDYQPGFATALMTKDLGLAANALRANGVDGQLGALAAEIYTRFNQTDADRDFSAIVTDVRNRSEQEGDQ GT:EXON 1|1-299:0| BL:SWS:NREP 1 BL:SWS:REP 5->294|MMSB_MYCTU|2e-70|53.4|290/294| PROS 7->20|PS00895|3_HYDROXYISOBUT_DH|PDOC00697| SEG 41->60|aradgatvvataaeaaagre| SEG 98->114|adakaaaeravaaghra| SEG 121->129|ggvagaaag| SEG 246->257|lglaanalrang| BL:PDB:NREP 1 BL:PDB:REP 5->290|2gf2D|2e-48|38.5|286/294| RP:PDB:NREP 1 RP:PDB:REP 4->286|3ckyC|7e-55|32.9|277/296| RP:PFM:NREP 1 RP:PFM:REP 4->160|PF03446|2e-19|38.9|157/160|NAD_binding_2| HM:PFM:NREP 1 HM:PFM:REP 3->160|PF03446|3.9e-52|44.3|158/163|NAD_binding_2| GO:PFM:NREP 3 GO:PFM GO:0004616|"GO:phosphogluconate dehydrogenase (decarboxylating) activity"|PF03446|IPR006115| GO:PFM GO:0006098|"GO:pentose-phosphate shunt"|PF03446|IPR006115| GO:PFM GO:0055114|"GO:oxidation reduction"|PF03446|IPR006115| RP:SCP:NREP 2 RP:SCP:REP 4->160|1vpdA2|8e-29|31.2|157/161|c.2.1.6| RP:SCP:REP 162->286|3cumA1|4e-23|36.0|125/134|a.100.1.1| HM:SCP:REP 2->165|1pgjA2|9.9e-47|41.1|163/0|c.2.1.6|1/1|NAD(P)-binding Rossmann-fold domains| HM:SCP:REP 162->298|2cvzA1|1.4e-30|41.2|131/0|a.100.1.1|1/1|6-phosphogluconate dehydrogenase C-terminal domain-like| OP:NHOMO 1597 OP:NHOMOORG 719 OP:PATTERN ------1122222221-211111----1-1-------------1------1----1------11---1 -12-11--------33311-15--281111116757116521131111----423222--1-1---52221-------1---3--1-------------------1-2----------------------------32222---12211-111----11112111-1-1---11----1--1-121-1---2121121222222222223122222222222221111111211-------------------1-1-11-1---11--111111111-1---------------------------------------------1-11-------1-1-1---11------111--33-----1---------2123222-----417762232332211221222223-11511919452-444344565568552223341211544111111116--11111-----------------------------32232-385377555575----557B22221383D8885-444334322525555222---1221111111111222-12--12-111--2-2-11222-1--1-1--11------------------1-----1121223-122212222223122222211222---1111------2211-1-3333343434-3433433323333343441112111--3233323333333333-21122221--11111111111----1111-1111122311113-2--1-11--133333241123-55653443433342323-1-1--1-1-111211111232221121111111------2---------------1-1------------------1----------------1-1 ----111-311-111635423232122111111221222232211122111384-2211212111----1--1-1------11111---11131111111111111-25335433222121222222325H2-33512212-2211112221141332222311211211111211132H121-254773531164433 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 296 STR:RPRED 99.0 SQ:SECSTR cccEEEEEcccTTHHHHHHHHHHTTcEEEEEcccHHHHHHHHTTTcEEcccHHHHHHHccEEEEccccHHHHHHHHTcHHHHccTTcEEEEcccccHHHHHHHHHHHHHTTcEEEEccEEcHHHHHHHTcEEEEEEccHHHHHHHHHHHHHHEEEEEEEEcTTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTccHHHHHHHHHTcTTccHHHHHHcHHHTHHcccccTccccccccHHHHHHHHHHHHHHHHHHTcccHHHHHHHHHHHHHHHTcTTccGGGGHHHHHHHHTcc### DISOP:02AL 291-292, 294-299| PSIPRED cccEEEEEEccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHcccEEcccHHHHHHcccEEEEEccccHHHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHccccEEEccccccccccccccEEEEEcccHHHHHHHHHHHHHHcccEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccccc //