[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55888.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.55.1d.24.1
:352 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   196->250 2v7yA PDBj 6e-04 34.5 %
:RPS:PDB   198->272 1bu6O PDBj 6e-09 23.0 %
:RPS:SCOP  175->280 2retB1  d.24.1.5 * 9e-07 4.7 %
:HMM:SCOP  108->277 1hjoA2 c.55.1.1 * 8.3e-17 25.9 %
:RPS:PFM   221->272 PF02782 * FGGY_C 4e-04 39.2 %
:HMM:PFM   199->273 PF02782 * FGGY_C 1.5e-06 28.4 74/197  
:HMM:PFM   301->319 PF11177 * DUF2964 0.00082 52.6 19/62  
:BLT:SWISS 174->279 HSCA_BURA4 4e-08 37.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55888.1 GT:GENE BAD55888.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1150380..1151438) GB:FROM 1150380 GB:TO 1151438 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55888.1 LENGTH 352 SQ:AASEQ MVLVLGVSAGAGGARAILTHSDQPHLPPIDSCLVARRPGRGVDEPVFDAIRQMCRSAEERDELIASTAVTCRCPLHAEAIRRAAGRTRLTIVDEPLAQLRYLRFTGRLPESGSVILYDLGSSGLTLTQADCRSEAVIAGTRSTVLGGDGYDLLLRRRLARAGVRADRAATRRHREELSSARVVTAIDPESGDRAVLTHSDLADLCAAGVQHSAALVRHLIEETGVPPAALVLVGGCTRSPIVRSELVRAIDLPIVYDPEPEVVSARGAVLLAAERPSGDVHMPRVRTRAALAALPRPGVGRRKVLAAAAVTVALGGTVAGLLALERDSADRPGGGSAPTRIELGTVAPLPTK GT:EXON 1|1-352:0| BL:SWS:NREP 1 BL:SWS:REP 174->279|HSCA_BURA4|4e-08|37.7|106/622| SEG 2->16|vlvlgvsagaggara| SEG 145->172|lggdgydlllrrrlaragvradraatrr| SEG 284->300|rvrtraalaalprpgvg| SEG 304->324|vlaaaavtvalggtvagllal| BL:PDB:NREP 1 BL:PDB:REP 196->250|2v7yA|6e-04|34.5|55/504| RP:PDB:NREP 1 RP:PDB:REP 198->272|1bu6O|6e-09|23.0|74/497| RP:PFM:NREP 1 RP:PFM:REP 221->272|PF02782|4e-04|39.2|51/191|FGGY_C| HM:PFM:NREP 2 HM:PFM:REP 199->273|PF02782|1.5e-06|28.4|74/197|FGGY_C| HM:PFM:REP 301->319|PF11177|0.00082|52.6|19/62|DUF2964| GO:PFM:NREP 2 GO:PFM GO:0005975|"GO:carbohydrate metabolic process"|PF02782|IPR018485| GO:PFM GO:0016773|"GO:phosphotransferase activity, alcohol group as acceptor"|PF02782|IPR018485| RP:SCP:NREP 1 RP:SCP:REP 175->280|2retB1|9e-07|4.7|106/159|d.24.1.5| HM:SCP:REP 108->277|1hjoA2|8.3e-17|25.9|170/194|c.55.1.1|1/1|Actin-like ATPase domain| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------11-1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 222 STR:RPRED 63.1 SQ:SECSTR ########################################################TcEEcEEEEEEEEEEEEHHHHHHHHHHHccccEEEEEHHHHHHHHHccHHH##HHHcEEEEEEccccEEEEEEETTEEEEEEEEcccHHHHHHHHHHHHTccHHHHHHHHHHHcccccTTccccEEEEEcTHHTTHHHHHHTccHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcGGGGcHHHHHHHHHHHTcEEEEEccccTHHHHHHHHHHHHHTHTcc######################################################################## DISOP:02AL 331-337| PSIPRED cEEEEEEcccccccEEEEccccccccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEccHHHHHHHHHHHcccEEEEEccHHHHHHHHHcccccccccEEEEEEEcccEEEEEEEEEcccEEEEccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccEEEEEEcccccEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccccccccEEEEEEEcccccccccEEEccccccccHHHHHHHHHcccccccccccccccccccccccccEEccccc //