[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55889.1
DDBJ      :             putative transcriptional regulator
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  80/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
a.4.5
:185 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   35->173 2nyxB PDBj 2e-12 34.4 %
:RPS:PDB   41->168 2a61A PDBj 3e-17 29.0 %
:RPS:SCOP  40->166 2fbiA1  a.4.5.28 * 3e-21 25.2 %
:HMM:SCOP  35->171 2fbkA1 a.4.5.28 * 7.8e-26 30.4 %
:RPS:PFM   71->121 PF01047 * MarR 5e-05 39.2 %
:HMM:PFM   64->120 PF01047 * MarR 1.3e-13 36.4 55/59  
:BLT:SWISS 40->129 YUSO_BACSU 4e-08 33.0 %
:PROS 95->129|PS01117|HTH_MARR_1

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55889.1 GT:GENE BAD55889.1 GT:PRODUCT putative transcriptional regulator GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1151605..1152162) GB:FROM 1151605 GB:TO 1152162 GB:DIRECTION - GB:PRODUCT putative transcriptional regulator GB:PROTEIN_ID BAD55889.1 LENGTH 185 SQ:AASEQ MIGTMSRPRPLPLDPIEEAHRQWVDHGWGDAADGMAAVTSLVRAQQIVMARVDEALRPSGLTFSRYELLRLLSFSKTGALPMAKASARLQVHPTSVTNTVDRLEAAGLVTRVPHPSDRRATLIEITDAGRDSVARATKELNDKVFAQPGLPPERLHTLLQLLAEFRHAAGDFDTGDAPVRWARNG GT:EXON 1|1-185:0| BL:SWS:NREP 1 BL:SWS:REP 40->129|YUSO_BACSU|4e-08|33.0|88/155| PROS 95->129|PS01117|HTH_MARR_1|PDOC00861| BL:PDB:NREP 1 BL:PDB:REP 35->173|2nyxB|2e-12|34.4|131/145| RP:PDB:NREP 1 RP:PDB:REP 41->168|2a61A|3e-17|29.0|124/142| RP:PFM:NREP 1 RP:PFM:REP 71->121|PF01047|5e-05|39.2|51/59|MarR| HM:PFM:NREP 1 HM:PFM:REP 64->120|PF01047|1.3e-13|36.4|55/59|MarR| GO:PFM:NREP 3 GO:PFM GO:0003700|"GO:transcription factor activity"|PF01047|IPR000835| GO:PFM GO:0005622|"GO:intracellular"|PF01047|IPR000835| GO:PFM GO:0006355|"GO:regulation of transcription, DNA-dependent"|PF01047|IPR000835| RP:SCP:NREP 1 RP:SCP:REP 40->166|2fbiA1|3e-21|25.2|123/136|a.4.5.28| HM:SCP:REP 35->171|2fbkA1|7.8e-26|30.4|135/0|a.4.5.28|1/1|"Winged helix" DNA-binding domain| OP:NHOMO 124 OP:NHOMOORG 80 OP:PATTERN -------------------------------------------------------------------- 11--31--------12233-31113133333212221248-21311--111-211111----1-1111123---------------------------------------------------------------------------------------------------------------------------11111111-1111111-----111----------------------------------------------11--------------------------------------------------------------------------------------------------------------------------------------------------1--1--1---1-----------------------------------------------------------------------------1----------1--------------1---------------------------------------------1------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 141 STR:RPRED 76.2 SQ:SECSTR ################################ccccHHHHHHHHHHHHHHHHHTTHHHHTccHHHHHHHHHHHEHHHccccHHHHHHHHTccHHHHHHHHHHHHHTTcEEEEEETTEEEEEEEEEcHHHHHHHHHHHHHHHHHHHHTTHHcHHHHHHHHHHHHHHHHHHHTcc############ DISOP:02AL 1-28, 180-185| PSIPRED ccccccccccccccHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccccHHHHHHHHcccHHHHHHHHHHHHHcccEEcccccccccEEEEEEcHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcccccccccccccccc //