[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55891.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:322 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   134->261 PF11303 * DUF3105 6e-29 56.3 %
:HMM:PFM   133->262 PF11303 * DUF3105 4e-49 48.4 128/130  
:HMM:PFM   30->114 PF07466 * DUF1517 0.00091 22.9 83/289  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55891.1 GT:GENE BAD55891.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1153762..1154730) GB:FROM 1153762 GB:TO 1154730 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55891.1 LENGTH 322 SQ:AASEQ MVWAGEHLRAGTAADRSVTNPTRVTTSREHTRAMPSSNSASKSAKAVRAAGKTSSRKRGGGKGQLPTKRPIPWLAIGAAAVIIALVGALAYSLVPKYREQAELERYTPSAEQQDPAEQIPGIVEVDYSGATGKHVSASERVAYDRTPAFGGSHDQEWADCTGAVYDRPIRTENAVHSLEHGAVWIAYNPDKIDNAGLDTLKGKVEGKQYTMMSPYPGLDTAVSLQAWGHQLKVDSPDDKRINQFITALRQNPYTHPEVGGSCSNPPFGENPNPFDPTPPGPDAKPVDGSGIAADVSEFGGMVPGVPGIPGVPSAPVPGQPTQ GT:EXON 1|1-322:0| TM:NTM 1 TM:REGION 72->94| SEG 36->63|ssnsasksakavraagktssrkrgggkg| SEG 74->90|laigaaaviialvgala| SEG 271->287|pnpfdptppgpdakpvd| SEG 299->318|ggmvpgvpgipgvpsapvpg| RP:PFM:NREP 1 RP:PFM:REP 134->261|PF11303|6e-29|56.3|126/129|DUF3105| HM:PFM:NREP 2 HM:PFM:REP 133->262|PF11303|4e-49|48.4|128/130|DUF3105| HM:PFM:REP 30->114|PF07466|0.00091|22.9|83/289|DUF1517| OP:NHOMO 34 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- ------------------------------------2323----2----11-112-1---11--1111121-----------1-------------------------------------------------------------1--------------------------------------111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 5-7, 29-67, 103-118, 281-285, 287-288, 314-322| PSIPRED cccccccccccccccccccccccccccHHHHHcccccccHHHHHHHHHHcccHHHHccccccccccccccccEEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHccccEEEEcccccccEEEcccEEEEcccccccccccccHHHHcccccccccccHHHHHHHcccEEEEEEccccccHHHHHHHHHHHccccEEEEcccccccccEEEEEcccEEEEccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //