[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55903.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  2/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:152 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   47->100 PF11368 * DUF3169 0.00017 27.8 54/248  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55903.1 GT:GENE BAD55903.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1168462..1168920 GB:FROM 1168462 GB:TO 1168920 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55903.1 LENGTH 152 SQ:AASEQ MSFTPTPVPGPDAPLKSALRYGLIGLAVLVVLSAAIAGAAAGLPGLWGALLGAAIGGVFILTTAAVVLFGAKLPPSTAGLVMLVSWVAKVLLVLIAVAILNRFDFYDRVALFLTVIGALVIVLGAETYGVLRQKVPYVTTTAGDPDPADRAD GT:EXON 1|1-152:0| TM:NTM 4 TM:REGION 20->42| TM:REGION 50->72| TM:REGION 79->101| TM:REGION 109->131| SEG 22->61|gliglavlvvlsaaiagaaaglpglwgallgaaiggvfil| SEG 87->100|vakvllvliavail| HM:PFM:NREP 1 HM:PFM:REP 47->100|PF11368|0.00017|27.8|54/248|DUF3169| OP:NHOMO 2 OP:NHOMOORG 2 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-3, 145-152| PSIPRED ccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEcccccccccccc //