[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55912.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  39/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:140 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   21->133 PF10739 * DUF2550 3e-22 47.8 %
:HMM:PFM   6->133 PF10739 * DUF2550 3.6e-46 45.3 128/129  
:BLT:SWISS 20->127 Y1147_MYCLE 2e-32 57.4 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55912.1 GT:GENE BAD55912.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1176677..1177099 GB:FROM 1176677 GB:TO 1177099 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55912.1 LENGTH 140 SQ:AASEQ MVVLIILVLLLVAVAVVSLYRLVMIRRGGTSAILRVLPASGGQGWRHGLIRYDEDRLVFFKLTSLKLGPDAVIHRRGIDIGNRRGPVGDEYDIMTDEIIVTEVSDSEGRYELALDRGARAAFLSWVESRPSDRARRMRGL GT:EXON 1|1-140:0| BL:SWS:NREP 1 BL:SWS:REP 20->127|Y1147_MYCLE|2e-32|57.4|108/147| TM:NTM 1 TM:REGION 2->24| SEG 2->17|vvliilvlllvavavv| RP:PFM:NREP 1 RP:PFM:REP 21->133|PF10739|3e-22|47.8|113/129|DUF2550| HM:PFM:NREP 1 HM:PFM:REP 6->133|PF10739|3.6e-46|45.3|128/129|DUF2550| OP:NHOMO 39 OP:NHOMOORG 39 OP:PATTERN -------------------------------------------------------------------- -----1111111-111111-11111111111111111111--------------------1---11111------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 134-135, 139-140| PSIPRED cHHHHHHHHHHHHHHHHHHHHHHEEEccccEEEEEEccccccccEEEEEEEEEcccEEEEEEEcccccccEEEEcccEEEEccccccHHHHHHHHccEEEEEEEccccEEEEEEccHHHHHHHHHHHHccHHHHHHHccc //