[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55915.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:141 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   45->102 PF08688 * ASD1 0.00022 25.9 58/182  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55915.1 GT:GENE BAD55915.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1185414..1185839) GB:FROM 1185414 GB:TO 1185839 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55915.1 LENGTH 141 SQ:AASEQ MGLPVWTGIACQEGNSRRGNAAGISDGCGCPPSSTEAPPSSTEAPPSSTDAPRSSTDAAPSSTEAMVAGLGLEQDRACSGKGQAVARRGPRARLPAQTATRSGTAWSDLATVFVVLVLYTVARPTLHLTHVVVTGTEARRC GT:EXON 1|1-141:0| TM:NTM 1 TM:REGION 103->125| SEG 31->49|ppssteappssteappsst| SEG 125->134|tlhlthvvvt| HM:PFM:NREP 1 HM:PFM:REP 45->102|PF08688|0.00022|25.9|58/182|ASD1| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 15-21, 32-62| PSIPRED ccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHcccccccccccccccHHHHccccccccccHHcccccHHHHHHHHHHHHHHHHHccccEEEEEEEEcccccccc //