[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55916.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  34/68 : Bacteria  71/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
c.52.1
:243 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   17->228 2vldB PDBj 2e-10 30.0 %
:RPS:SCOP  121->233 2inbA1  c.52.1.32 * 6e-10 17.9 %
:RPS:PFM   16->230 PF01939 * DUF91 2e-85 75.7 %
:HMM:PFM   14->243 PF01939 * DUF91 4.6e-84 40.5 222/228  
:BLT:SWISS 14->243 Y1459_RHOSR e-110 86.2 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55916.1 GT:GENE BAD55916.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1185960..1186691 GB:FROM 1185960 GB:TO 1186691 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55916.1 LENGTH 243 SQ:AASEQ MLVRGRRAPKLLPVRLVIARCQVDYVGRLTAHLPMARRLLMIKADGSVLVHSDGGSYKPLNWMSPPCWLDERDLATAEVPETAKALWVVTNKAGEELRITIEDIEHDSSHDLGIDPGLVKDGVEAHLQELLAEHVQTLGPGYTLIRREYMTAIGPVDLLCRDAGGATVAVEIKRRGEIDGVEQLTRYLELLNRDPLLAPVSGVFAAQQIKPQARTLAEDRGIRCLTLDYDALRGTESNEFRLF GT:EXON 1|1-243:0| BL:SWS:NREP 1 BL:SWS:REP 14->243|Y1459_RHOSR|e-110|86.2|224/224| BL:PDB:NREP 1 BL:PDB:REP 17->228|2vldB|2e-10|30.0|190/222| RP:PFM:NREP 1 RP:PFM:REP 16->230|PF01939|2e-85|75.7|206/213|DUF91| HM:PFM:NREP 1 HM:PFM:REP 14->243|PF01939|4.6e-84|40.5|222/228|DUF91| RP:SCP:NREP 1 RP:SCP:REP 121->233|2inbA1|6e-10|17.9|95/128|c.52.1.32| OP:NHOMO 108 OP:NHOMOORG 105 OP:PATTERN 11---1--11111111111---1-12211111111-1-----------------1111111------- ----111111111111111-11111111111111111111111111111111111111--111111111111111111--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 190 STR:RPRED 78.2 SQ:SECSTR ################EEEEEEEEEEcccEEEEEEEEEEEEEcTTccEEEEcc#ccccccEEEcTTcEEEEccEE#############EEEcccccEEEEEEEEEEEE#####EEEEccccccccHHHHHHHHcGGGTcTTcEEEEEEEEETTEEEEEEE#cTTccEEEEEEcccccHHHHHH#HHHHHHH#HHHHcccEEEEEEEccccHHHHHHHHHHTcEEEEcc############### DISOP:02AL 1-7| PSIPRED cccccccccccccEEEEEEEEEEEEEEccEEEcccccEEEEEEEcccEEEEccccccccccccccccEEEEccccccHHcccccEEEEEEEccccEEEEEEEEEEEEEEEEEcccHHHHHHHHHHHHHHHHHHcHHHHHcccEEEEEEEEccccEEEEEEEcccccEEEEEEEccccHHHHHHHHHHHHHHHcccccccEEEEEEcccccHHHHHHHHHcccEEEEEccccccccccccEEEc //