[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55917.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  47/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:101 amino acids
:PSIPRED
:DISOPRED
:BLT:SWISS 3->101 Y1356_MYCBO 7e-22 53.3 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55917.1 GT:GENE BAD55917.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1186702..1187007 GB:FROM 1186702 GB:TO 1187007 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55917.1 LENGTH 101 SQ:AASEQ MPRRKPRADRKAGRLDGGRPLSDVFGSVEPGPDGDEDYAVRTIPAARALKTYRCPGCDHEIAPGVAHIVAWPRFGGEDDRRHWHRGCWNGRRTRRITRRWS GT:EXON 1|1-101:0| BL:SWS:NREP 1 BL:SWS:REP 3->101|Y1356_MYCBO|7e-22|53.3|92/98| SEG 91->99|rrtrritrr| OP:NHOMO 47 OP:NHOMOORG 47 OP:PATTERN -------------------------------------------------------------------- ----1-1111----11111-11---111111-11111111111111-1-11-111-1---11--1-11111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-22, 96-101| PSIPRED cccccccccccccccccccccccccccEEccccccccEEEEEccccccEEEEEcccccccccccccEEEEEcccccccccccccHHHHccccccccccccc //