[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55921.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  21/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:119 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   33->82 PF03073 * TspO_MBR 0.00081 24.0 50/144  
:BLT:SWISS 13->103 MMPLB_STRCO 3e-23 50.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55921.1 GT:GENE BAD55921.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1190105..1190464 GB:FROM 1190105 GB:TO 1190464 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55921.1 LENGTH 119 SQ:AASEQ MGYFDLRSVAGRFRFFAVLEALSWLGLLIGMGFKYLPDPGNEVGVKIFGPVHGAIFMLFVLTALLAARELNWNWKTTVLALLSSIPPFFTVVFEVWAVRTGKLTAADSADAAGAVRASS GT:EXON 1|1-119:0| BL:SWS:NREP 1 BL:SWS:REP 13->103|MMPLB_STRCO|3e-23|50.0|90/847| TM:NTM 3 TM:REGION 14->36| TM:REGION 45->67| TM:REGION 76->98| SEG 105->118|aadsadaagavras| HM:PFM:NREP 1 HM:PFM:REP 33->82|PF03073|0.00081|24.0|50/144|TspO_MBR| OP:NHOMO 21 OP:NHOMOORG 21 OP:PATTERN -------------------------------------------------------------------- --------------1------1---1------11111111----1----111111---------11--1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------ ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 117-119| PSIPRED cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEEEEHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccHHHHHHHHHHHccEEEcccccccccccccc //