[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55927.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  12/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:199 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   45->99 PF07681 * DoxX 9e-04 45.1 %
:HMM:PFM   44->129 PF07681 * DoxX 1.3e-22 48.8 82/85  
:HMM:PFM   175->197 PF10617 * DUF2474 7.4e-05 39.1 23/40  
:BLT:SWISS 44->99 MHQP_BACSU 6e-11 44.6 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55927.1 GT:GENE BAD55927.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1199946..1200545 GB:FROM 1199946 GB:TO 1200545 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55927.1 LENGTH 199 SQ:AASEQ MPSLTTESERPQGLIMTTTHTAPVRDRDTITTTAFDNAAAADIGLLIVRVVFGGLLAAHGTQKLFGWFSGPGLDANNAMFEAMGYNPGALFGTLAGLTELVGGLLLAFGLFTPLAAAIALGTMINAINATWGPGLFGQGGWEMGLLFGAVAAGLGFTGAGRYALDAGRPWERNGLVWGVGVLGLAVVSAVLTLILKWAL GT:EXON 1|1-199:0| BL:SWS:NREP 1 BL:SWS:REP 44->99|MHQP_BACSU|6e-11|44.6|56/100| TM:NTM 4 TM:REGION 39->61| TM:REGION 96->118| TM:REGION 139->161| TM:REGION 175->197| SEG 28->42|dtitttafdnaaaad| SEG 100->117|lvgglllafglftplaaa| SEG 144->160|gllfgavaaglgftgag| SEG 174->191|glvwgvgvlglavvsavl| RP:PFM:NREP 1 RP:PFM:REP 45->99|PF07681|9e-04|45.1|51/85|DoxX| HM:PFM:NREP 2 HM:PFM:REP 44->129|PF07681|1.3e-22|48.8|82/85|DoxX| HM:PFM:REP 175->197|PF10617|7.4e-05|39.1|23/40|DUF2474| OP:NHOMO 13 OP:NHOMOORG 12 OP:PATTERN -------------------------------------------------------------------- ---------------------------------1112----1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------1-----------------------------------------11-1---1---------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-8| PSIPRED ccccccccccccHHHccccccccccccHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHcccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHcc //