[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55931.1
DDBJ      :             hypothetical protein
Swiss-Prot:CLPS_NOCFA   RecName: Full=ATP-dependent Clp protease adapter protein clpS;

Homologs  Archaea  0/68 : Bacteria  65/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.45.1
:106 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   36->77 2wa9G PDBj 7e-06 40.5 %
:RPS:PDB   32->105 3dnjB PDBj 3e-17 29.7 %
:RPS:SCOP  21->103 1lzwA  d.45.1.2 * 2e-19 25.3 %
:HMM:SCOP  25->104 1mbxC_ d.45.1.2 * 4.5e-22 38.8 %
:RPS:PFM   36->102 PF02617 * ClpS 3e-11 40.3 %
:HMM:PFM   28->102 PF02617 * ClpS 1.8e-26 34.7 75/82  
:BLT:SWISS 1->106 CLPS_NOCFA 9e-60 100.0 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55931.1 GT:GENE BAD55931.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1204925..1205245 GB:FROM 1204925 GB:TO 1205245 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55931.1 LENGTH 106 SQ:AASEQ MGLCNTNLTLSAAQATPEAVEYTEILEAEDRPWVTVVWDDPVNLMHYVTYIFQKLFGYSKAKATELMLQVHNEGKAVVSSGSRDKMEHDVRRLHAAGLWATMQRDD GT:EXON 1|1-106:0| SW:ID CLPS_NOCFA SW:DE RecName: Full=ATP-dependent Clp protease adapter protein clpS; SW:GN Name=clpS; OrderedLocusNames=NFA_10860; SW:KW Complete proteome. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->106|CLPS_NOCFA|9e-60|100.0|106/106| BL:PDB:NREP 1 BL:PDB:REP 36->77|2wa9G|7e-06|40.5|42/83| RP:PDB:NREP 1 RP:PDB:REP 32->105|3dnjB|3e-17|29.7|74/81| RP:PFM:NREP 1 RP:PFM:REP 36->102|PF02617|3e-11|40.3|67/76|ClpS| HM:PFM:NREP 1 HM:PFM:REP 28->102|PF02617|1.8e-26|34.7|75/82|ClpS| GO:PFM:NREP 1 GO:PFM GO:0030163|"GO:protein catabolic process"|PF02617|IPR003769| RP:SCP:NREP 1 RP:SCP:REP 21->103|1lzwA|2e-19|25.3|83/91|d.45.1.2| HM:SCP:REP 25->104|1mbxC_|4.5e-22|38.8|80/87|d.45.1.2|1/1|ClpS-like| OP:NHOMO 65 OP:NHOMOORG 65 OP:PATTERN -------------------------------------------------------------------- ---111111111-111111-11111111111111111111111111111111111111--11-11111111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------11- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 74 STR:RPRED 69.8 SQ:SECSTR ###############################EEEEEEEccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcEEEEEEEEHHHHHHHHHHHTTccccEEEEEc# DISOP:02AL 1-3, 15-30, 104-106| PSIPRED cccccccEEEEccccccccccEEEEEEcccccEEEEEEEcccccHHHHHHHHHHHHcccHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHccccEEEEcccc //