[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55932.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  39/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:195 amino acids
:PSIPRED
:DISOPRED
:RPS:PFM   18->193 PF09438 * DUF2017 3e-25 50.9 %
:HMM:PFM   10->194 PF09438 * DUF2017 4.2e-74 57.2 180/181  
:BLT:SWISS 7->193 Y1166_MYCLE 2e-32 38.7 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55932.1 GT:GENE BAD55932.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1205272..1205859 GB:FROM 1205272 GB:TO 1205859 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55932.1 LENGTH 195 SQ:AASEQ MMGRAAVRKWTRKNSLGGLKLRAEMDAHEAEVLRSLVGAVSGLLAERAQSAPEDELSALTGLRTGNTAPPDDPRLARLLPDFHRSEPGSPDADRAGLNSALRALHEPEIIDAKLAAGSVVLDTVPARGGKIVLTPEQADAWLSALTDVRLALGTVLGIDAETPDQLDPDDPRAPHLDVYHWLTWMQDSLLQALAP GT:EXON 1|1-195:0| BL:SWS:NREP 1 BL:SWS:REP 7->193|Y1166_MYCLE|2e-32|38.7|186/217| SEG 68->81|appddprlarllpd| RP:PFM:NREP 1 RP:PFM:REP 18->193|PF09438|3e-25|50.9|167/181|DUF2017| HM:PFM:NREP 1 HM:PFM:REP 10->194|PF09438|4.2e-74|57.2|180/181|DUF2017| OP:NHOMO 39 OP:NHOMOORG 39 OP:PATTERN -------------------------------------------------------------------- ----111111111111111-11111111111111111111----------------------1-111-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-9, 64-68| PSIPRED ccccHHHHHHHHHHccccccEEEEEcHHHHHHHHHHHHHHHHHHccHHccccHHHHHHHHcccccccccccccHHHHHccHHccccccccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccEEEEcHHHHHHHHHHHHHHHHHHHHHHcccccHHHcccccccHHHHHHHHHHHHHHHHHHHHHHcc //