[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55935.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  1/68 : Bacteria  83/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.15.3
:95 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   2->90 3dwgC PDBj 9e-29 66.3 %
:RPS:PDB   2->90 3dwgC PDBj 2e-15 66.3 %
:RPS:SCOP  1->94 1wgkA  d.15.3.3 * 2e-14 20.2 %
:HMM:SCOP  1->90 1wgkA_ d.15.3.3 * 4.8e-21 43.3 %
:RPS:PFM   11->90 PF02597 * ThiS 6e-06 41.1 %
:HMM:PFM   6->90 PF02597 * ThiS 4.9e-19 41.6 77/78  
:BLT:SWISS 1->90 CF1A_MYCTU 7e-29 66.7 %

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55935.1 GT:GENE BAD55935.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1207542..1207829 GB:FROM 1207542 GB:TO 1207829 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55935.1 LENGTH 95 SQ:AASEQ MSVTVSIPTIMRGLTGGEKRVQAEGATLSALIENLDANHPGLAERLLKDGKLNRFVNIYVDDEDVRFAGGLAAEVPEGASVTILPAVAGGAPDLR GT:EXON 1|1-95:0| BL:SWS:NREP 1 BL:SWS:REP 1->90|CF1A_MYCTU|7e-29|66.7|90/93| BL:PDB:NREP 1 BL:PDB:REP 2->90|3dwgC|9e-29|66.3|89/92| RP:PDB:NREP 1 RP:PDB:REP 2->90|3dwgC|2e-15|66.3|89/92| RP:PFM:NREP 1 RP:PFM:REP 11->90|PF02597|6e-06|41.1|73/79|ThiS| HM:PFM:NREP 1 HM:PFM:REP 6->90|PF02597|4.9e-19|41.6|77/78|ThiS| GO:PFM:NREP 1 GO:PFM GO:0006790|"GO:sulfur metabolic process"|PF02597|IPR003749| RP:SCP:NREP 1 RP:SCP:REP 1->94|1wgkA|2e-14|20.2|94/114|d.15.3.3| HM:SCP:REP 1->90|1wgkA_|4.8e-21|43.3|90/0|d.15.3.3|1/1|MoaD/ThiS| OP:NHOMO 96 OP:NHOMOORG 84 OP:PATTERN -----------------------1-------------------------------------------- 2-1-2---------1--11-11--1111-11111111-221111---------11-----112-1122222-----------1-1111--------------------1-------------------------1-11111----111111112211-----111111111-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1-1----------------------------11111---------------------------------------------------------------1----------------------------------------------1-----------------------------------------------------------1--------------------------------------------------------------------------------------------------------------------------------------------1-- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 89 STR:RPRED 93.7 SQ:SECSTR #cEEEEccGGGGGGTTTccEEEEccccHHHHHHHHHHHcTTHHHHHccTTcccTTEEEEETTEEGGGTTGGGccccTTcEEEEEEccTTc##### DISOP:02AL 91-95| PSIPRED cEEEEEEEEccHHHccccEEEEcccccHHHHHHHHHHHHHHHHHHHccccccccEEEEEEcccccHHHcccccccccccEEEEEccccccccccc //