[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55937.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  3/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
d.58.4
:90 amino acids
:PSIPRED
:DISOPRED
:RPS:SCOP  3->84 1mwqA  d.58.4.7 * 1e-06 19.5 %
:HMM:SCOP  1->88 1mwqA_ d.58.4.7 * 4.8e-18 30.7 %
:HMM:PFM   1->84 PF03795 * YCII 7.3e-10 27.4 84/95  
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55937.1 GT:GENE BAD55937.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1208843..1209115) GB:FROM 1208843 GB:TO 1209115 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55937.1 LENGTH 90 SQ:AASEQ MRYVLFYESADDVMPLAMQHFPAHQAHWQPFAEAGTLLGIGTFGDPQTEGSMAIFRTREAAEEFARADPFVLNGVVKNWVVRAWDDAMST GT:EXON 1|1-90:0| SEG 53->67|aifrtreaaeefara| HM:PFM:NREP 1 HM:PFM:REP 1->84|PF03795|7.3e-10|27.4|84/95|YCII| RP:SCP:NREP 1 RP:SCP:REP 3->84|1mwqA|1e-06|19.5|82/100|d.58.4.7| HM:SCP:REP 1->88|1mwqA_|4.8e-18|30.7|88/100|d.58.4.7|1/1|Dimeric alpha+beta barrel| OP:NHOMO 3 OP:NHOMOORG 3 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-1------------------------------------------------------------1----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 90-91| PSIPRED cEEEEEEEEcccHHHHHHHccHHHHHHHHHHHHcccEEEEEccccccccEEEEEEccHHHHHHHHHccHHHHcccEEEEEEEEHHHHHcc //