[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55941.1
DDBJ      :             hypothetical protein
Swiss-Prot:NTPA_NOCFA   RecName: Full=Nucleoside-triphosphatase;         EC=3.6.1.15;AltName: Full=Nucleoside triphosphate phosphohydrolase;         Short=NTPase;

Homologs  Archaea  29/68 : Bacteria  828/915 : Eukaryota  14/199 : Viruses  0/175   --->[See Alignment]
c.51.4
:206 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   3->186 2pyuA PDBj 9e-37 48.3 %
:RPS:PDB   5->186 1b78A PDBj 2e-31 27.5 %
:RPS:SCOP  1->186 1k7kA  c.51.4.1 * 3e-50 46.2 %
:HMM:SCOP  1->201 1k7kA_ c.51.4.1 * 1e-60 48.7 %
:RPS:PFM   6->186 PF01725 * Ham1p_like 1e-33 52.8 %
:HMM:PFM   7->197 PF01725 * Ham1p_like 1.4e-62 48.9 186/189  
:BLT:SWISS 1->186 NTPA_NOCFA 5e-99 100.0 %
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55941.1 GT:GENE BAD55941.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1211754..1212374 GB:FROM 1211754 GB:TO 1212374 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55941.1 LENGTH 206 SQ:AASEQ MTMARVLVASRNAKKLAELRRILDDAGVAGVQIVGLDDVPPYDEAPETGATFEENALAKARDGAAATGLPCVADDSGLAVDALNGMPGVLSARWSGTHGDDAANNALLLAQLRDVPDERRGARFVSACALVVPGGTETVVRGEWPGTIGRKPMGEGGFGYDPLFVPDGGDVTAAQLTPAAKDAASHRGRALRHLLPALAALADRTE GT:EXON 1|1-206:0| SW:ID NTPA_NOCFA SW:DE RecName: Full=Nucleoside-triphosphatase; EC=3.6.1.15;AltName: Full=Nucleoside triphosphate phosphohydrolase; Short=NTPase; SW:GN OrderedLocusNames=NFA_10960; SW:KW Complete proteome; Hydrolase. SW:EXACT T SW:FUNC + BL:SWS:NREP 1 BL:SWS:REP 1->186|NTPA_NOCFA|5e-99|100.0|186/206| GO:SWS:NREP 1 GO:SWS GO:0016787|"GO:hydrolase activity"|Hydrolase| SEG 102->112|aannalllaql| SEG 187->204|rgralrhllpalaaladr| BL:PDB:NREP 1 BL:PDB:REP 3->186|2pyuA|9e-37|48.3|178/208| RP:PDB:NREP 1 RP:PDB:REP 5->186|1b78A|2e-31|27.5|167/184| RP:PFM:NREP 1 RP:PFM:REP 6->186|PF01725|1e-33|52.8|176/188|Ham1p_like| HM:PFM:NREP 1 HM:PFM:REP 7->197|PF01725|1.4e-62|48.9|186/189|Ham1p_like| GO:PFM:NREP 1 GO:PFM GO:0016787|"GO:hydrolase activity"|PF01725|IPR002637| RP:SCP:NREP 1 RP:SCP:REP 1->186|1k7kA|3e-50|46.2|182/207|c.51.4.1| HM:SCP:REP 1->201|1k7kA_|1e-60|48.7|197/209|c.51.4.1|1/1|ITPase-like| OP:NHOMO 889 OP:NHOMOORG 871 OP:PATTERN 11---1-1-----------1111----------111----------1-111111111111--111-11 1111111111111111111-111111111111111111111122111111111111111111111111111-1111111111-1111111111111---111111111111111111111111111111-111-1-111111111111111111111211222111111112211122111211111111111111111111111111112111111111111111111111111111111111111111111111111121112211111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111111-11111111111111111111111111111111111111111111111-1111111-----------------------------111111111111111111111111111111111111111-11111-11111111111111111111111111111111111111111111111111111111111111111111111111---------1111111111111111111111111111111111111--11111------11111111111111111-11111111111111111111111111111111111111111111111111111111111111111--111111111111111111111111111111111111111111111111111111111111111111111211111111111111111111111111111111111111---1-111111----1---1--------11------1111111111111 --------------1-----------1---------------------------------------------------------------------1-1-1--1-1--1----1-------------1------------------------------------------1----1------------------1---1 ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 186 STR:RPRED 90.3 SQ:SECSTR HTTccEEEEcccHHHHHHHHHHTTTcTTEEEccEEEEccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEEEEEGGGTTcEETTHHHHHHHTHHHHHHHHHHHHHHTTccccccEEEEEEEEEEEETTEEEEEEEEEEEEEEccccccccccGGGGcEEETTccccGGGccHHHHTTTcH#################### DISOP:02AL 204-206| PSIPRED ccccEEEEEEccHHHHHHHHHHHHHccccEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHcccEEEEccEEEEEccccccccEEHHHccccccHHHHHHHHHHHHHcccccccEEEEEEEEEEEccccEEEEEEEEEEEEEEEcccccccccccEEEEEccccccHHcccHHHHHcccHHHHHHHHHHHHHHHHHHHcc //