[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55942.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  45/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:127 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   34->114 PF01284 * MARVEL 0.0002 21.0 81/144  
:BLT:SWISS 28->127 Y1377_MYCBO 2e-26 50.0 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55942.1 GT:GENE BAD55942.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1212396..1212779) GB:FROM 1212396 GB:TO 1212779 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55942.1 LENGTH 127 SQ:AASEQ MNAGDNETVSVDRPAAPAPAVDPARRAKIKSALLRYRVLAWFTGLWLLLLTGEMIAKYGFDADPPSWIAIVHGWVYFVYLILTADLALKVRWPLGRTVGTLLAGTVPLLSFFVEHANAKQVKRDFGV GT:EXON 1|1-127:0| BL:SWS:NREP 1 BL:SWS:REP 28->127|Y1377_MYCBO|2e-26|50.0|100/120| TM:NTM 3 TM:REGION 37->59| TM:REGION 67->89| TM:REGION 96->118| SEG 11->27|vdrpaapapavdparra| SEG 39->52|lawftglwlllltg| HM:PFM:NREP 1 HM:PFM:REP 34->114|PF01284|0.0002|21.0|81/144|MARVEL| OP:NHOMO 45 OP:NHOMOORG 45 OP:PATTERN -------------------------------------------------------------------- -----11111111111111-11111111111111111111----11--1-----------11--11-1111---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-11| PSIPRED ccccccccEEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc //