[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55949.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  4/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
e.23.1
:141 amino acids
:SECSTR
:PSIPRED
:DISOPRED
:BLT:PDB   4->100 1amuB PDBj 3e-04 24.7 %
:RPS:PDB   3->100 1amuB PDBj 2e-08 24.5 %
:RPS:SCOP  3->100 1amuA  e.23.1.1 * 7e-07 24.5 %
:HMM:SCOP  4->132 1pg4A_ e.23.1.1 * 1.9e-16 32.6 %
:HMM:PFM   30->92 PF00501 * AMP-binding 1.5e-12 38.1 63/418  
:BLT:SWISS 4->99 MYCB_BACSU 3e-06 33.3 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55949.1 GT:GENE BAD55949.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1219367..1219792 GB:FROM 1219367 GB:TO 1219792 GB:DIRECTION + GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55949.1 LENGTH 141 SQ:AASEQ MQTTADTLLIRPVSRSDAAVAVSTPEGTLTHRELDSWSNRLARVLLGMGAGPGVVVAVAVEPLIEDIVSRTAIAKTGATAVPAGTEVPAPAFGITTEDARGGLGDGIAWLVLDDRSTLLRYLTGSDAPLTDAELRGLRPAS GT:EXON 1|1-141:0| BL:SWS:NREP 1 BL:SWS:REP 4->99|MYCB_BACSU|3e-06|33.3|96/5369| TM:NTM 1 TM:REGION 42->64| SEG 49->60|gagpgvvvavav| BL:PDB:NREP 1 BL:PDB:REP 4->100|1amuB|3e-04|24.7|97/508| RP:PDB:NREP 1 RP:PDB:REP 3->100|1amuB|2e-08|24.5|98/508| HM:PFM:NREP 1 HM:PFM:REP 30->92|PF00501|1.5e-12|38.1|63/418|AMP-binding| RP:SCP:NREP 1 RP:SCP:REP 3->100|1amuA|7e-07|24.5|98/510|e.23.1.1| HM:SCP:REP 4->132|1pg4A_|1.9e-16|32.6|129/643|e.23.1.1|1/1|Acetyl-CoA synthetase-like| OP:NHOMO 20 OP:NHOMOORG 4 OP:PATTERN -------------------------------------------------------------------- ------------------------------------5465----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- STR:NPRED 121 STR:RPRED 85.8 SQ:SECSTR ##ccHHHHHHHHHHHcTTcEEEEETTEEEEHHHHHHHHHHHHHHHHHHTccTTcEEEEEccccHHHHHHHHHHHHTTcEEEEccTTccHHHHHHHHHHHcHHHHHHcccEEEEcTTTHHHHHH################## DISOP:02AL 137-141| PSIPRED ccccHHHHHHHHHHHccccEEEEccccEEcHHHHHHHHHHHHHHHHHcccccccEEEEEEcccHHHHHHHHHHHHHccEEEEccccccHHHHHHHHHHccccccccccEEEEccHHHHHHccccccccccccccccccccc //