[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55951.1
DDBJ      :             putative ABC transporter ATP-binding protein
Swiss-Prot:             

Homologs  Archaea  67/68 : Bacteria  900/915 : Eukaryota  184/199 : Viruses  0/175   --->[See Alignment]
c.37.1
:322 amino acids
:PSIPRED
:DISOPRED
:BLT:PDB   5->226 1vplA PDBj 3e-28 33.3 %
:RPS:PDB   1->218 2dwoA PDBj 2e-38 9.4 %
:RPS:SCOP  8->231 1b0uA  c.37.1.12 * 9e-41 23.7 %
:HMM:SCOP  8->218 1ii8.1 c.37.1.12 * 3.3e-60 36.4 %
:RPS:PFM   138->165 PF00005 * ABC_tran 2e-04 53.6 %
:HMM:PFM   45->165 PF00005 * ABC_tran 7e-19 31.9 113/118  
:HMM:PFM   30->55 PF03215 * Rad17 4.4e-05 45.8 24/498  
:BLT:SWISS 5->318 DRRA_STRPE 7e-70 48.2 %
:PROS 137->151|PS00211|ABC_TRANSPORTER_1
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55951.1 GT:GENE BAD55951.1 GT:PRODUCT putative ABC transporter ATP-binding protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1233258..1234226 GB:FROM 1233258 GB:TO 1234226 GB:DIRECTION + GB:PRODUCT putative ABC transporter ATP-binding protein GB:PROTEIN_ID BAD55951.1 LENGTH 322 SQ:AASEQ MNDTAVVVEGVEKSFGAVRALRGVDFVAHQGEVLGILGPNGAGKTTTVNILSTLVTPDAGRASVAGHDVVADPAGVRRCIMLTGQFAALDDMLSGYENLVMFGRLMGLRKRAARARAEELLVEFDLTDAAGRRVGTYSGGMRRRIDIACGLVVRPDVVFLDEPTTGLDPRSRQGVWDLVGGFRAHGITTLLTTQYLEEADALCDRIIVIDHGVVIAEGTADELKSRTGGSYCEVVPLRLEDLPAIAAVLGPLLPPGHPAPGPDADRLAIPAPDGAKTLAEALRRLDAAGLELVDIALRRPSLDDVFLHLTGHPAATESEVPA GT:EXON 1|1-322:0| BL:SWS:NREP 1 BL:SWS:REP 5->318|DRRA_STRPE|7e-70|48.2|311/330| PROS 137->151|PS00211|ABC_TRANSPORTER_1|PDOC00185| SEG 103->121|grlmglrkraararaeell| SEG 242->262|lpaiaavlgpllppghpapgp| BL:PDB:NREP 1 BL:PDB:REP 5->226|1vplA|3e-28|33.3|222/238| RP:PDB:NREP 1 RP:PDB:REP 1->218|2dwoA|2e-38|9.4|202/449| RP:PFM:NREP 1 RP:PFM:REP 138->165|PF00005|2e-04|53.6|28/123|ABC_tran| HM:PFM:NREP 2 HM:PFM:REP 45->165|PF00005|7e-19|31.9|113/118|ABC_tran| HM:PFM:REP 30->55|PF03215|4.4e-05|45.8|24/498|Rad17| GO:PFM:NREP 2 GO:PFM GO:0005524|"GO:ATP binding"|PF00005|IPR003439| GO:PFM GO:0016887|"GO:ATPase activity"|PF00005|IPR003439| RP:SCP:NREP 1 RP:SCP:REP 8->231|1b0uA|9e-41|23.7|224/258|c.37.1.12| HM:SCP:REP 8->218|1ii8.1|3.3e-60|36.4|209/370|c.37.1.12|1/1|P-loop containing nucleoside triphosphate hydrolases| OP:NHOMO 21841 OP:NHOMOORG 1151 OP:PATTERN LLA3CHCCEECCECGGU8JGGIHIYGJPMNPF95843366654HO9MM9CZTJ4DOEHJEFADAE-33 CHbH*EIGKKLGFBGEDDD-DN77LpDDDDDEYYWZahzvKgOnPkRTQLEAaYTA9L12dfiLoVdstwKBAAAZHFECRIY53434BAB828664--77B656I7CBB111111122222228A886A576CCARQQXUAAAaNMHKNJIIMPEE868556EJDQVXQC485554484564RLKHEIE7EDTiijijbmrYlllfgjTTWWNZlkjITUaULUSUUSRQkwEBBBDBBBBBBBBABAD9DAMGEDTTB8AFARP9AVYJEADGDEEDNMNMLGPYPPUSRURSSSTSSIGGGGHIJJIIHIYRRJIJSRTHLXJYZaaabfddMcKLYVVLIIGiKQHKnHLIAolJKNHTFDHLDKJA7CKAPKKKE68867FG***EASqefvgbcadbYecbY*-JO*JJwNXl*D5*************xBCEbb*kejphYn88888888VFE6DQIc221-2111221113222112-21131111D78B85c*zfocjmkrdSYXYVhhy*fdeeRhml*cgoc5CUSQTNVNPgWwox*LMJDD89MDBAAAA9ABBFENQLTmCJDVNENPONT9LJLHGNIFIPMMRaXIW3666744445532222222258555A8GJTBKDEAD8LBCCDCCCGDCCDCDFBEFD1-58C88------STmYGVLSSSNSPNQQQ-SPQQRNPTPSSRSNNRNNSlrncaJLHPOLLLONOONMMOMLLcMMJNONPC1XUVWWVVTTXXX117878888ABBBF6XOWDDEIJH6ABA9B9CLAAA9A6A479LEQSRPLTabTNWNTSZYc7664656566DLJNHHHIHKMMKKBAEDBDDCED665611CA77679933333232H6634512-3241362231226433334EQRBDLQLNM7JC ----EDA-IA2EDK65331155341335423226331222322533334334453462343221111-1-1111111-11-111---1-42232213353--257324DEJCCFICIAAC6ADBUW8PAc*L3ICRDCE9K8AKC9D9ABKA9*ALFAR59dCB6J9GEGiBGB65585t33475I66P1KD36VJYRE ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 310-322| PSIPRED ccccEEEEEEEEEEEccEEEEEccEEEEEccEEEEEEccccccHHHHHHHHHHcccccccEEEEEccccHHHHHHHHHHcccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccHHHHccHHHHcccHHHHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHcEEEEEEccEEEEEccHHHHHHHHcccEEEEEEEEcccHHHHHHHHHHHccccEEEEEccccEEEEEEcccHHHHHHHHHHHHHccccEEEEEEccccHHHHHHHHHcccccccccccc //