[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55952.1
DDBJ      :             putative ABC transporter membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  27/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:307 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   191->217 PF07784 * DUF1622 0.00024 34.6 26/77  
:BLT:SWISS 104->271 DRRB_STRPE 1e-08 27.1 %
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55952.1 GT:GENE BAD55952.1 GT:PRODUCT putative ABC transporter membrane protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1234223..1235146 GB:FROM 1234223 GB:TO 1235146 GB:DIRECTION + GB:PRODUCT putative ABC transporter membrane protein GB:PROTEIN_ID BAD55952.1 LENGTH 307 SQ:AASEQ MSGPTPGGGAASARGAARAGAVPVIDAVATEPATPAHRGAWLTDLRARPVRARQWWVLTTRLITPSVKTGEVLTSVFAPAAFTASFYIPLKTVMTFAGTGFSSYAQFMMPLVILQAAAFTAIGAAFRSATDAVAGLDRRFGSMPIGKLVPFGARMSGNVFRLAIALTAALVCGHVIGFRFRLDALHTLGFLALALAIGIAFTVGADVIGTASKSPEATTQALVLPPLILGMLSTALAPATQFPQWVQPFVRNQPISQFAIGLRALAGDTAGNAGVVSWSLLGPSLLWLAGILALALPLAVRFATRRS GT:EXON 1|1-307:0| BL:SWS:NREP 1 BL:SWS:REP 104->271|DRRB_STRPE|1e-08|27.1|166/100| TM:NTM 6 TM:REGION 75->97| TM:REGION 110->132| TM:REGION 157->179| TM:REGION 187->209| TM:REGION 223->245| TM:REGION 278->300| SEG 2->21|sgptpgggaasargaaraga| SEG 116->129|aaaftaigaafrsa| SEG 188->201|lgflalalaigiaf| SEG 274->299|gvvswsllgpsllwlagilalalpla| HM:PFM:NREP 1 HM:PFM:REP 191->217|PF07784|0.00024|34.6|26/77|DUF1622| OP:NHOMO 33 OP:NHOMOORG 27 OP:PATTERN -------------------------------------------------------------------- ----2----------2111-11221-111111111131111----------------------------------------------------------------------------------------------------------------------------------------------------------------1------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------1---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-16, 37-39, 41-44, 306-307| PSIPRED ccccccccccHHHHHHHHccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccHHcccHHHHHHHHHccHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccc //