[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55953.1
DDBJ      :             putative ABC transporter membrane protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  25/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:269 amino acids
:PSIPRED
:DISOPRED
:HMM:PFM   27->229 PF01061 * ABC2_membrane 1.4e-20 26.6 184/208  
:TM
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55953.1 GT:GENE BAD55953.1 GT:PRODUCT putative ABC transporter membrane protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION 1235146..1235955 GB:FROM 1235146 GB:TO 1235955 GB:DIRECTION + GB:PRODUCT putative ABC transporter membrane protein GB:PROTEIN_ID BAD55953.1 LENGTH 269 SQ:AASEQ MGAAHRAKPTYPENSPITLAANVSVQTQRLLLRWSRSPVALLETLIIPCLLLFMLDTVVGGQIQKFAGDDALYGSVPMVAVVGALSGAVAGGVMLGRERDDGLLARFWVLPVHRASGLVARVLAEGCRILLGTLVVVGVGYLLGFRFHQGVPAALAFVAVPVLFGLAFATLVTAVAVYTAKAALVEGVAILSSLLMFFSTGFVPLIAYPEWIQPVVRNQPMSAAVDAMKALSLGGPLADPLTRTVLWSLGIIAVCAVPAAIGYRRASRS GT:EXON 1|1-269:0| TM:NTM 6 TM:REGION 41->63| TM:REGION 74->96| TM:REGION 120->142| TM:REGION 154->176| TM:REGION 185->207| TM:REGION 242->263| SEG 41->52|lletliipclll| SEG 78->96|mvavvgalsgavaggvmlg| SEG 130->144|llgtlvvvgvgyllg| SEG 150->185|gvpaalafvavpvlfglafatlvtavavytakaalv| HM:PFM:NREP 1 HM:PFM:REP 27->229|PF01061|1.4e-20|26.6|184/208|ABC2_membrane| OP:NHOMO 28 OP:NHOMOORG 25 OP:PATTERN -------------------------------------------------------------------- ---------------2111-11111-11111111113111-11-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-6, 8-9, 266-269| PSIPRED cccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHccHHHccHHHHHHHHHccHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc //