[GTOP] [HELP] [ORGANISMS] [SEARCH] [SUMMARY]
Nocardia farcinica IFM 10152 (nfar0)
Gene : BAD55954.1
DDBJ      :             hypothetical protein
Swiss-Prot:             

Homologs  Archaea  0/68 : Bacteria  1/915 : Eukaryota  0/199 : Viruses  0/175   --->[See Alignment]
:245 amino acids
:PSIPRED
:DISOPRED
:SEG

SeqInfo AminoSeq See neighboring genes
Links GIB DAD Abbreviations Back to title page
GT:ID BAD55954.1 GT:GENE BAD55954.1 GT:PRODUCT hypothetical protein GT:DATABASE GIB00210CH01 GT:ORG nfar0 GB:ACCESSION GIB00210CH01 GB:LOCATION complement(1236171..1236908) GB:FROM 1236171 GB:TO 1236908 GB:DIRECTION - GB:PRODUCT hypothetical protein GB:PROTEIN_ID BAD55954.1 LENGTH 245 SQ:AASEQ MTDEEGTVSGDLEVTLDEAGRGLVRYRDTDTWYTIGNLDGEPPHPWDSVQRLAAAIEADLGARDAAGNVIPFEVFPEDDSAAGADTPAPDGPDAPTAGTGTTSDIPAQTATVTTTTGTGTTDTTGTGTTGTTGTGTTATDADSADTISPDTPSGTTPTGTTADPAPTDTASATTTHEAPTETTTDAASAGPTTNPAPTDAASAGAAADASATGTTSDAVSTGTATNPAPTGADSTEAADDPRSTR GT:EXON 1|1-245:0| SEG 78->104|ddsaagadtpapdgpdaptagtgttsd| SEG 109->189|tatvttttgtgttdttgtgttgttgtgttatdadsadtispdtpsgttptgttadpaptdtasatttheaptetttdaasa| SEG 198->232|tdaasagaaadasatgttsdavstgtatnpaptga| OP:NHOMO 1 OP:NHOMOORG 1 OP:PATTERN -------------------------------------------------------------------- ------------------------------------1-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------- DISOP:02AL 1-5, 38-245| PSIPRED cccccccccccEEEEccccccEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc //